Recombinant Klebsiella pneumoniae Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Pathogenesis

Cardiolipin synthases are central to maintaining membrane integrity and regulating two-component systems (TCSs) critical for bacterial adaptation to host environments. Key findings include:

  • Membrane Protein Regulation: CL modulates the activity of sensor kinases (e.g., SaeS in Staphylococcus aureus), linking lipid composition to virulence gene expression .

  • Mutational Adaptation: Mutations in Cls (e.g., H215R, R218Q in enterococci) enhance enzyme activity, conferring resistance to daptomycin (DAP) by altering membrane charge and permeability .

  • Species-Specific Pathways: In K. pneumoniae, CL metabolism intersects with phospholipase D (PLD) activity, influencing virulence factors like biofilm formation and toxin production .

Genomic Context and Evolutionary Insights

The clsA gene is conserved across K. pneumoniae strains, though nucleotide polymorphisms in related capsule synthesis genes (e.g., wcaJ, wbaP) influence virulence phenotypes like hypermucoviscosity . For example:

  • Capsule Biosynthesis: Mutations in wcaJ reduce capsular polysaccharide production, altering serum resistance and virulence .

  • Horizontal Gene Transfer: Capsular polysaccharide operons (cps) are horizontally acquired, enabling rapid adaptation to host environments .

Comparative Analysis with Other Cls Enzymes

OrganismCls ActivityRole in PathogenicityReference
K. pneumoniaeFull-length enzyme (486 aa)Membrane stabilization, TCS regulation
Enterococcus faeciumMutant variants (H215R, R218Q)Daptomycin resistance, altered membrane charge
Staphylococcus aureusCL-dependent SaeS kinase activationVirulence gene expression (e.g., saeQ)

Future Directions

  • Vaccine Development: Cls may serve as a target for serotype-independent vaccines, given its conserved role in membrane biogenesis .

  • Antibiotic Resistance: Inhibitors targeting Cls could disrupt CL synthesis, synergizing with existing antimicrobials to combat resistant strains .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
clsA; cls; KPK_2120; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Klebsiella pneumoniae (strain 342)
Target Names
clsA
Target Protein Sequence
MTTFYTVVNWLVILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSFGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAEDNSPVAESLFKLCERRQGIGGVKGNQ LQLLTESDDVMQALIRDIQLARHNIEMVFYIWQPGGMADSVAESLMAAARRGVHCRLMLD SAGSVAFFRSPWAAMMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMVMIDNYIAYTGSM NMVDPRYFKQDSGVGQWIDLMARMEGPVATSMGIVYSCDWEIETGKRILPPPPDVNIMPF EEASGHTIHTIASGPGFPEDLIHQALLTAAYAAKEHLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSLLVGWASRAFFTELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLVIDDAGFGSDLAAVQDDYISRSRLLDARRWLKRPLWQRIVERLFY FFSPLL
Uniprot No.

Target Background

Function

This recombinant Klebsiella pneumoniae Cardiolipin synthase (Cls) catalyzes the reversible transfer of a phosphatidyl group between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL) (diphosphatidylglycerol) and glycerol.

Database Links

KEGG: kpe:KPK_2120

Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cardiolipin synthase and what is its functional role in Klebsiella pneumoniae?

Cardiolipin synthase (cls) is a membrane-associated enzyme responsible for synthesizing cardiolipin, a crucial phospholipid component of bacterial membranes. In K. pneumoniae, as in other Gram-negative bacteria, cardiolipin plays essential roles in:

  • Maintaining membrane integrity and fluidity

  • Supporting proper function of membrane proteins

  • Mediating bacterial responses to environmental stresses

  • Potentially modulating virulence mechanisms

Based on studies in related pathogens like Staphylococcus aureus, cardiolipin appears to play a significant role in bacterial pathogenesis by modulating two-component signaling systems that regulate virulence factors . In S. aureus, cls2 is required for full activity of the SaeRS two-component system, which controls virulence gene expression .

How many cls genes are typically found in Klebsiella pneumoniae and how do they differ?

K. pneumoniae typically contains multiple cls genes similar to other Gram-negative bacteria:

GenePrimary FunctionRegulationStructural Features
cls1Constitutive cardiolipin synthesisExpressed during normal growthContains characteristic phospholipase D domains
cls2Stress-responsive cardiolipin synthesisUpregulated during membrane stress and stationary phaseContains phospholipase D catalytic motifs HxK(x)4D(x)6GSxN

In similar bacterial systems like S. aureus, cls2 appears more critical for virulence functions than cls1. Studies have shown that ectopic expression with cls2 can fully restore activity of virulence-associated two-component systems, while cls1 cannot .

What experimental approaches are effective for isolating and characterizing recombinant cls?

For successful expression and isolation of recombinant K. pneumoniae cls:

  • Vector Selection: pET expression systems with T7 promoters often yield good results for membrane-associated proteins

  • Expression Conditions:

    • Lower temperatures (16-20°C) often improve proper folding

    • Use of bacterial strains with membrane protein expression enhancements (C41, C43)

    • Induction with lower IPTG concentrations (0.1-0.5 mM)

  • Membrane Extraction:

    • Gentle lysis methods (lysozyme treatment followed by mechanical disruption)

    • Careful separation of membrane fractions through differential centrifugation

  • Solubilization:

    • Screen detergents (DDM, LDAO, CHAPS) for optimal enzyme stability and activity

    • Maintain appropriate lipid-to-protein ratios during purification

For characterization, activity assays measuring the conversion of phosphatidylglycerol to cardiolipin remain the gold standard for functional assessment.

What pitfalls should researchers avoid when working with recombinant Cardiolipin synthase?

Common methodological challenges include:

  • Protein Aggregation: Membrane proteins like cls often aggregate during overexpression. Address by optimizing expression temperature and detergent conditions.

  • Loss of Activity: Cardiolipin synthase activity can diminish rapidly during purification. Include lipid supplementation in buffers to stabilize the enzyme.

  • Contamination Issues: Phospholipid contaminants can interfere with accurate activity measurements. Perform thorough lipid extraction and analysis.

  • Protein Orientation: Ensure proper orientation in membrane mimetics for accurate functional studies.

  • Storage Stability: Develop appropriate storage conditions (e.g., glycerol addition, flash-freezing protocols) to maintain enzyme activity.

How can I verify that my recombinant cls preparation is properly folded and active?

Methodological approaches to verify proper folding and activity include:

  • Circular Dichroism: Assess secondary structure elements characteristic of properly folded cls

  • Thermal Shift Assays: Measure protein stability under various buffer conditions

  • Size Exclusion Chromatography: Confirm monodispersity versus aggregation

  • Activity Assays:

    • Radiometric assays using labeled phosphatidylglycerol

    • Mass spectrometry-based detection of cardiolipin formation

    • Thin-layer chromatography to separate reaction products

  • Reconstitution Studies: Incorporate purified enzyme into liposomes to verify activity in a membrane-like environment

How does cardiolipin modulate two-component system activity in bacterial pathogens?

Research in S. aureus has revealed sophisticated mechanisms by which cardiolipin affects bacterial signaling and virulence:

  • Direct Binding Interaction: Purified sensor kinases like SaeS directly bind to cardiolipin and phosphatidylglycerol .

  • Kinase Modulation: Cardiolipin-deficient membranes demonstrate reduced kinase activity of sensor proteins .

  • Regulatory Effects: The absence of cardiolipin alters the transcription of multiple two-component system regulons, suggesting broad regulatory effects .

Specifically, studies have shown that deletion of cls2 significantly decreases transcript levels of virulence genes controlled by the Sae system . When examining eight different two-component systems in S. aureus, the transcript abundance of sensor kinase genes was reduced in cls mutants .

What experimental designs are most appropriate for studying the impact of cls mutations on bacterial virulence?

Implementation science offers valuable experimental frameworks for studying virulence factors like cls :

Experimental DesignStrengthsLimitationsApplication to cls Research
Randomized Controlled TrialStrongest causal inferenceResource intensiveCompare wild-type vs. cls knockout strains in infection models
Quasi-experimental designsFeasible in complex settingsWeaker causal inferenceStudy cls expression under different host conditions
Interrupted Time SeriesDetects changes over timeRequires multiple measurement pointsMonitor cls expression during infection progression
Stepped Wedge DesignAll subjects eventually receive interventionComplex analysisStudy cls function across different bacterial strains

When designing experiments specifically for cls research, incorporate both in vitro phenotypic assays and in vivo infection models to comprehensively assess virulence impacts .

How can I optimize expression systems for difficult-to-express membrane proteins like cls?

For challenging membrane proteins like cls, consider these methodological refinements:

  • Expression System Modifications:

    • Use of specialized strains (BL21-AI, Lemo21)

    • Codon optimization for K. pneumoniae genes

    • Fusion partners that enhance membrane protein folding (MBP, SUMO)

    • Inducible promoters with precise control (araBAD)

  • Expression Conditions:

    • Growth media supplementation with glycerol and specific phospholipids

    • Osmotic stress adaptation (sorbitol, betaine addition)

    • Controlled rate of protein synthesis through temperature adjustment

  • Alternative Expression Systems:

    • Cell-free expression in the presence of liposomes or nanodiscs

    • Specialized membrane protein expression hosts (C41, C43)

    • Use of rhamnose-inducible promoters for gentler expression kinetics

The methodology should be tailored to maintain protein stability while achieving sufficient yields for downstream applications.

What role does cardiolipin play in antibiotic resistance mechanisms of K. pneumoniae?

While direct evidence specific to K. pneumoniae cardiolipin synthase is limited in the provided search results, research on related pathogens suggests several mechanisms:

  • Membrane Permeability: Cardiolipin alters membrane fluidity and permeability, potentially affecting antibiotic penetration.

  • Two-Component System Modulation: By regulating sensor kinases, cardiolipin may affect expression of efflux pumps and other resistance determinants .

  • Stress Response Coordination: Cardiolipin helps bacteria adapt to environmental stresses, including antibiotic exposure.

In K. pneumoniae isolates, extended-spectrum β-lactamase (ESBL) production represents a key resistance mechanism . Future research should investigate whether cardiolipin influences the expression or activity of these resistance determinants through membrane organization effects.

What techniques are most effective for studying cls-membrane interactions at the molecular level?

For detailed molecular studies of cls-membrane interactions:

  • Biophysical Approaches:

    • Surface plasmon resonance with membrane mimetics

    • Microscale thermophoresis for binding affinity measurements

    • Hydrogen-deuterium exchange mass spectrometry to identify membrane interaction sites

  • Structural Biology Methods:

    • Cryo-electron microscopy of cls in nanodiscs

    • Solid-state NMR to study dynamics in membrane environments

    • X-ray crystallography of detergent-solubilized protein

  • Computational Approaches:

    • Molecular dynamics simulations of cls in membrane bilayers

    • Coarse-grained modeling of protein-lipid interactions

    • Binding site prediction algorithms

These methods provide complementary insights into how cls positions itself in the membrane and interacts with its lipid substrates.

How can genomic approaches advance our understanding of cls function in K. pneumoniae pathogenesis?

Comparative genomic analysis offers powerful insights into cls function:

  • Genome Sequencing Projects: Analysis of clinical K. pneumoniae isolates reveals genetic diversity in cls genes across strains with varying virulence .

  • Transcriptomic Profiling: RNA-Seq analysis under infection-relevant conditions can identify co-regulated genes and regulatory networks involving cls.

  • Genomic Island Analysis: Studies have identified genomic islands specific to virulent K. pneumoniae strains (such as K2 serotype reference strain Kp52.145) that may interact with cardiolipin-dependent processes .

  • Integrative Genomics: Combining genomic data with phenotypic assays can reveal associations between cls variants and virulence traits.

Genomic approaches have successfully identified novel virulence factors in K. pneumoniae, such as a phospholipase D family protein (PLD1) that renders mutants avirulent in pneumonia models . Similar approaches could elucidate the role of cls in pathogenesis.

What are the methodological considerations for designing inhibitors targeting Cardiolipin synthase?

When developing potential inhibitors of Klebsiella pneumoniae cls:

  • Target Validation:

    • Confirm essentiality or virulence contribution through genetic approaches

    • Verify conservation across clinical isolates to ensure broad-spectrum activity

  • Assay Development:

    • Establish robust enzymatic assays suitable for high-throughput screening

    • Develop cell-based secondary assays to confirm compound penetration

  • Structure-Based Design:

    • Model cls structure based on homologous proteins if crystal structure unavailable

    • Focus on catalytic domains containing phospholipase D motifs

    • Target substrate binding pockets with highest likelihood of specificity

  • Selectivity Considerations:

    • Ensure compounds don't inhibit human phospholipid biosynthetic enzymes

    • Test against other bacterial species to establish spectrum of activity

  • Physicochemical Properties:

    • Design compounds with properties suitable for penetrating both outer and inner membranes

    • Consider efflux pump susceptibility in resistant K. pneumoniae strains

What are the best techniques for measuring cardiolipin levels in bacterial membranes?

Accurate quantification of cardiolipin requires careful methodological considerations:

  • Lipid Extraction Protocols:

    • Modified Bligh-Dyer method optimized for phospholipids

    • Folch extraction with acidification to improve cardiolipin recovery

    • MTBE extraction for reduced phase interface contamination

  • Analytical Methods:

    • Thin-layer chromatography with densitometric analysis

    • HPLC with evaporative light scattering detection

    • Liquid chromatography-mass spectrometry for highest sensitivity and specificity

  • Standards and Controls:

    • Use of internal standards for accurate quantification

    • Synthetic cardiolipin standards for calibration curves

    • Control for extraction efficiency with spike-in experiments

  • Membrane Fractionation:

    • Separate inner and outer membranes to localize cardiolipin distribution

    • Sucrose gradient ultracentrifugation for membrane domain isolation

When comparing wild-type and cls mutant strains, consider both absolute cardiolipin levels and relative proportions among membrane phospholipids.

How can I establish reliable structure-function relationships for Cardiolipin synthase?

To elucidate structure-function relationships:

  • Mutagenesis Approaches:

    • Site-directed mutagenesis of catalytic residues

    • Domain swapping between cls1 and cls2

    • Truncation analysis to identify minimal functional units

  • Functional Assessment:

    • Activity assays with altered substrates

    • In vivo complementation studies with mutant variants

    • Membrane binding analyses of modified proteins

  • Computational Analysis:

    • Homology modeling based on related phospholipase D structures

    • Molecular dynamics simulations of substrate binding

    • Conservation analysis across bacterial species

  • Biophysical Characterization:

    • Thermal stability measurements of mutant proteins

    • Circular dichroism to assess structural changes

    • Limited proteolysis to identify flexible regions

What are the most robust experimental designs for studying cls gene function in vivo?

For studying cls function in pathogenesis contexts:

  • Genetic Manipulation Strategies:

    • Clean deletion mutants using allelic exchange

    • Complementation with wild-type and mutant variants

    • Inducible expression systems for temporal control

  • Animal Infection Models:

    • Mouse pneumonia models to assess respiratory infections

    • Urinary tract infection models for uropathogenic strains

    • Galleria mellonella (wax moth) larvae for initial virulence screening

  • Experimental Controls:

    • Include wild-type parental strain

    • Use vector-only controls for complementation

    • Perform growth rate normalization for virulence factor production

  • Statistical Considerations:

    • Power analysis to determine appropriate sample sizes

    • Account for biological variability with sufficient replication

    • Use appropriate statistical tests based on data distribution

Research in S. aureus has demonstrated that strains lacking cls2 or both cls1 and cls2 show reduced cytotoxicity to human neutrophils and decreased virulence in mouse infection models . Similar experimental designs could be applied to K. pneumoniae cls studies.

How might cls function differ between antibiotic-resistant and susceptible K. pneumoniae strains?

The relationship between cls function and antibiotic resistance merits investigation through:

  • Comparative Genomics:

    • Analyze cls sequences from extensively drug-resistant (XDR) versus susceptible isolates

    • Identify single nucleotide polymorphisms associated with resistance phenotypes

  • Membrane Lipidomics:

    • Compare cardiolipin content between resistant and susceptible strains

    • Analyze lipid composition changes upon antibiotic exposure

  • Transcriptional Regulation:

    • Examine cls expression patterns in response to antibiotics

    • Identify potential regulatory links between resistance determinants and cls

  • Genetic Manipulation Studies:

    • Overexpress or delete cls genes in resistant backgrounds

    • Assess impact on minimum inhibitory concentrations

Studies characterizing K. pneumoniae clinical isolates have identified various resistance mechanisms including ESBL production , but the specific role of membrane modifications through cls remains an important area for future research.

What is the potential for targeting Cardiolipin synthase in combination therapy approaches?

Exploring cls as a therapeutic target requires:

  • Synergy Testing:

    • Evaluate interactions between cls inhibitors and conventional antibiotics

    • Identify classes of antibiotics most affected by cardiolipin modulation

  • Resistance Development Assessment:

    • Measure frequency of resistance emergence to cls inhibitors

    • Characterize resistance mechanisms and fitness costs

  • Host-Pathogen Interaction Studies:

    • Determine if cls inhibition affects bacterial survival in host environments

    • Assess impact on immune evasion mechanisms

  • Pharmacological Considerations:

    • Develop appropriate pharmacokinetic/pharmacodynamic models

    • Establish optimal dosing regimens for combination approaches

Given that cardiolipin modulates multiple two-component systems in bacteria like S. aureus , targeting cls could potentially disrupt various virulence and resistance mechanisms simultaneously.

How can systems biology approaches enhance our understanding of cls in bacterial physiology?

Integrative approaches to understand cls function include:

  • Multi-Omics Integration:

    • Combine transcriptomics, proteomics, and lipidomics data from cls mutants

    • Develop network models of cls-dependent processes

  • Flux Analysis:

    • Measure phospholipid synthesis rates in wild-type versus cls mutants

    • Determine metabolic consequences of altered cardiolipin levels

  • High-Content Phenotypic Screening:

    • Assess multiple phenotypes simultaneously in cls mutants

    • Identify condition-specific requirements for cardiolipin

  • Computational Modeling:

    • Develop mathematical models of membrane biophysics incorporating cardiolipin

    • Simulate effects of cardiolipin alterations on membrane protein function

These approaches may reveal unexpected connections between cardiolipin synthesis and other cellular processes relevant to bacterial adaptation and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.