Recombinant Klebsiella pneumoniae Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing it accordingly.
Synonyms
rnfE; KPK_2379; Ion-translocating oxidoreductase complex subunit E; Rnf electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-232
Protein Length
full length protein
Species
Klebsiella pneumoniae (strain 342)
Target Names
rnfE
Target Protein Sequence
MSEVKDVIVQGLWKNNSALVQLLGMCPLLAVTSTATNALGLGLATTLVLTLTNLTISSLR RWTPAEIRIPIYVMIIASVVSVVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREILGNGTLFDGADSLLGSWAKVLRIEVFHTD TPFLLAMLPPGAFIGLGMMLAVKYLIDERSKQRKARAARAVSVAPADVTGKA
Uniprot No.

Target Background

Function
This protein is part of a membrane-bound complex that couples electron transfer with the translocation of ions across the membrane.
Database Links

KEGG: kpe:KPK_2379

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of RnfE in Klebsiella pneumoniae electron transport?

RnfE is a component of the electron transport complex in K. pneumoniae that contributes to energy metabolism through electron transfer processes. Similar to other membrane proteins in K. pneumoniae, understanding RnfE's structure and function requires evaluation of its interactions with other components of bacterial membranes. Research approaches should include protein expression analysis, structural characterization, and functional studies similar to those applied to outer membrane proteins like OmpA and OmpK36 . The protein's role in electron transport can be initially characterized through comparative genomics with other bacteria possessing Rnf complexes, followed by experimental validation using electron transport chain inhibitors and membrane potential measurements.

How is RnfE expression regulated in different K. pneumoniae strains?

RnfE expression likely varies among K. pneumoniae strains similar to what has been observed with other membrane proteins. Research indicates that membrane protein expression in K. pneumoniae is influenced by multiple environmental factors including temperature, iron availability, and carbon sources . To investigate RnfE regulation, researchers should employ quantitative RT-PCR to measure gene expression under various growth conditions. Additionally, TraDIS (transposon-directed insertion sequencing) approaches can help identify regulatory elements affecting rnfE expression, as this method has successfully identified regulatory networks for other K. pneumoniae proteins .

What are the key structural features of RnfE that distinguish it from other electron transport proteins?

While specific structural data on K. pneumoniae RnfE is limited, researchers can employ comparative analysis with homologous proteins. Structural characterization would typically involve techniques such as X-ray crystallography or cryo-electron microscopy following successful purification. Expression systems similar to those used for recombinant OmpA and OmpK36 proteins might be adapted, where a histidine-tagged (6xHis) construct enables purification via immobilized metal affinity chromatography . Key functional domains can be predicted through bioinformatic analysis and then confirmed through targeted mutagenesis studies.

What expression systems are most effective for producing recombinant K. pneumoniae RnfE?

Based on successful strategies with other K. pneumoniae membrane proteins, E. coli expression systems represent a practical approach for RnfE production. Drawing from protocols used for OmpA and OmpK36, researchers should consider:

  • Vector selection: pRSETA or similar vectors that allow for N-terminal His-tag fusion

  • Host strain selection: E. coli BL21(DE3) or derivatives optimized for membrane protein expression

  • Expression conditions: IPTG induction (typically 0.5-1mM) at lower temperatures (16-25°C) to minimize inclusion body formation

  • Extraction methods: Specialized detergent-based membrane protein extraction buffers

As membrane proteins often form inclusion bodies, researchers should be prepared to employ solubilization and refolding strategies, including step dialysis with decreasing concentrations of urea under reducing environments as demonstrated with other K. pneumoniae membrane proteins .

What purification strategies yield the highest purity and activity for recombinant RnfE?

RnfE purification likely requires a multi-step approach:

Purification StepMethodBuffer ConditionsExpected Results
Initial CaptureIMAC (Ni-NTA)20mM Tris-HCl, pH 8.0, 300mM NaCl, 20mM imidazole60-70% purity
Intermediate PurificationIon Exchange20mM Tris-HCl, pH 7.5, 50-500mM NaCl gradient80-90% purity
PolishingSize Exclusion20mM Tris-HCl, pH 7.5, 150mM NaCl>95% purity

For membrane proteins like RnfE, all buffers should contain appropriate detergents (e.g., n-dodecyl-β-D-maltoside or CHAPS) to maintain solubility and native conformation. Protein purity should be assessed via SDS-PAGE and Western blotting, similar to the validation methods used for OmpA and OmpK36 recombinant proteins . Activity should be measured through electron transport assays appropriate for the Rnf complex functionality.

How can researchers overcome common challenges in producing functional recombinant RnfE?

Several strategies can address common challenges:

  • Protein solubility issues: Employ fusion tags beyond His-tags, such as MBP or SUMO, which enhance solubility

  • Low expression levels: Optimize codon usage for E. coli and use specialized expression strains like C41(DE3) or C43(DE3) designed for membrane proteins

  • Misfolding: Consider cell-free expression systems or expression at reduced temperatures (16°C)

  • Loss of cofactors: Supplement growth media and purification buffers with predicted cofactors (iron-sulfur clusters for electron transport proteins)

  • Structural integrity validation: Circular dichroism spectroscopy to confirm secondary structure content

For refolding from inclusion bodies, researchers can adapt the step dialysis protocol with decreasing urea concentrations under reducing environments that has proven successful with other K. pneumoniae membrane proteins .

What assays can determine the electron transport activity of recombinant RnfE?

Functional characterization of RnfE should employ multiple complementary approaches:

  • Spectrophotometric assays: Measuring electron transfer using artificial electron acceptors like ferricyanide or DCPIP

  • Membrane potential measurements: Using voltage-sensitive fluorescent dyes (e.g., DiSC3(5))

  • Oxygen consumption rates: Using Clark-type electrodes to measure respiratory activity

  • Reconstitution in liposomes: Incorporating purified RnfE into artificial membrane systems to measure ion translocation

Researchers should compare the activity of wild-type versus site-directed mutants to identify critical residues involved in electron transport. Control experiments should include known inhibitors of electron transport to validate assay specificity.

How can researchers assess RnfE interactions with other components of the electron transport complex?

Interaction studies should employ multiple techniques:

  • Co-immunoprecipitation: Using antibodies against RnfE or predicted partner proteins

  • Bacterial two-hybrid assays: For screening potential protein-protein interactions

  • Surface plasmon resonance: For quantitative binding kinetics measurements

  • Crosslinking studies: Using chemical crosslinkers followed by mass spectrometry

  • Blue native PAGE: For analysis of intact complexes from membranes

These approaches will help establish the composition of the complete Rnf complex in K. pneumoniae and identify potential regulatory proteins that modulate its activity. Similar approaches have been successfully used to study protein complexes in the capsule regulatory network of K. pneumoniae .

What methods are most reliable for studying RnfE contribution to K. pneumoniae metabolism?

To connect RnfE function to broader bacterial metabolism, researchers should consider:

  • Gene knockout studies: Creating rnfE deletion mutants using CRISPR-Cas9 or homologous recombination

  • Metabolomic profiling: Comparing metabolite levels between wild-type and rnfE mutants

  • Growth curve analysis: Under different carbon sources and electron acceptors

  • Membrane potential measurements: In intact cells using fluorescent probes

  • Transcriptomic analysis: To identify compensatory pathways activated in rnfE mutants

These studies should be conducted under various environmental conditions (aerobic/anaerobic, different carbon sources) to fully understand RnfE's role in K. pneumoniae metabolism. Approaches similar to those used in studying the capsule regulatory network can be adapted to understand RnfE's role in broader metabolic networks .

Does RnfE contribute to K. pneumoniae virulence or antibiotic resistance?

While direct evidence for RnfE's role in virulence is currently limited, researchers can investigate this question through:

  • Infection models: Comparing the virulence of wild-type versus rnfE mutant strains in mouse models (similar to methods used for OmpA/OmpK36 vaccine studies)

  • Biofilm formation assays: To determine if RnfE affects biofilm development (which contributes to antibiotic resistance)

  • Antibiotic susceptibility testing: MIC determination for rnfE mutants versus wild-type

  • Macrophage survival assays: To assess whether RnfE contributes to intracellular survival

  • Gene expression analysis: To identify if RnfE expression changes during infection or antibiotic exposure

The challenge studies methodology developed for K. pneumoniae vaccine research could be adapted to study the contribution of RnfE to virulence .

How does RnfE expression vary between antibiotic-resistant and susceptible K. pneumoniae strains?

Researchers should investigate expression patterns across clinical isolates:

  • qRT-PCR analysis: Comparing rnfE expression levels in resistant versus susceptible isolates

  • Western blotting: Quantifying protein levels with specific antibodies

  • Immunohistochemistry: Visualizing RnfE localization in different strains

  • Promoter reporter assays: To identify regulatory differences in rnfE expression

  • Whole genome sequencing: To identify mutations in rnfE or its regulatory regions

Data should be analyzed in context of the strain background, including capsule type and antibiotic resistance profile. Similar approaches have been used to study variation in capsule production across K. pneumoniae strains .

Can RnfE be targeted to develop novel antimicrobial strategies against K. pneumoniae?

Potential antimicrobial strategies targeting RnfE might include:

  • Small molecule inhibitors: Targeting the electron transport function of RnfE

  • Peptide inhibitors: Designed to disrupt RnfE interactions with other complex components

  • Antibody-based approaches: Similar to those developed against OmpA and OmpK36

  • CRISPR-Cas delivery systems: For targeted gene silencing

Researchers should first validate RnfE as an essential protein or virulence factor before pursuing it as a therapeutic target. Experience from the development of vaccines targeting OmpA and OmpK36 suggests that membrane proteins can be effective targets if they are sufficiently conserved across strains .

How does the electron transport function of RnfE impact capsule production in K. pneumoniae?

Capsule production is energetically expensive and might be linked to electron transport efficiency. To investigate this connection:

  • Construct rnfE knockouts: Using methods similar to those employed in capsule regulation studies

  • Quantify capsule production: Using uronic acid assays or India ink staining

  • Density gradient separation: To physically separate bacterial populations based on capsule thickness

  • Transcriptomic analysis: To identify if rnfE mutation affects expression of capsule synthesis genes

  • Metabolic flux analysis: To determine if energy allocation to capsule synthesis changes when rnfE is altered

The density-TraDISort method described for studying capsule regulators could be particularly useful in establishing the relationship between RnfE and capsule production .

What role does RnfE play in K. pneumoniae adaptation to different environmental niches?

To understand RnfE's role in environmental adaptation:

  • Growth assays: Under various conditions (pH, temperature, oxygen levels, nutrient limitation)

  • Competition assays: Between wild-type and rnfE mutants in mixed cultures

  • RNA-seq analysis: To identify transcriptional responses linked to RnfE under different conditions

  • In vivo expression technology (IVET): To determine if rnfE is differentially expressed during infection

  • Environmental stress response assays: Testing susceptibility to oxidative stress, pH stress, etc.

This research would build on understanding of how K. pneumoniae adapts to different environments, similar to studies on capsule regulation in response to environmental cues .

How does the structure-function relationship in RnfE compare across different bacterial species?

Comparative analysis across species requires:

  • Phylogenetic analysis: Of RnfE homologs across bacterial species

  • Homology modeling: Based on available crystal structures of related proteins

  • Conserved domain analysis: To identify functionally critical regions

  • Complementation studies: Testing if RnfE from other species can function in K. pneumoniae

  • Chimeric protein construction: Swapping domains between RnfE from different species

This approach would help identify universally conserved features essential for function versus species-specific adaptations.

How can researchers overcome challenges in generating specific antibodies against RnfE?

Antibody production against membrane proteins like RnfE presents unique challenges:

  • Epitope selection: Choose hydrophilic, exposed regions predicted by topology models

  • Peptide synthesis: Use multiple peptides from different regions of RnfE

  • Recombinant fragment approach: Express soluble domains for immunization

  • Adjuvant selection: Critical for membrane protein fragments (consider KLH conjugation)

  • Antibody validation: Use rnfE knockout strains as negative controls

For polyclonal antibody production, similar approaches to those used for OmpA and OmpK36 can be adapted, where recombinant protein fragments elicited strong immune responses .

What strategies help resolve issues with RnfE protein stability during purification?

Membrane protein stabilization strategies include:

  • Detergent screening: Test multiple detergents (DDM, LMNG, CHAPS) at various concentrations

  • Lipid addition: Supplement with specific phospholipids to maintain native environment

  • Buffer optimization: Systematic testing of pH, salt concentration, and additives

  • Temperature control: Maintain samples at 4°C throughout purification

  • Protease inhibitor cocktails: Include throughout all purification steps

  • Reducing agents: Include DTT or β-mercaptoethanol to prevent oxidation of cysteine residues

The step dialysis approach with gradually decreasing denaturant concentration used for OmpA and OmpK36 can serve as a starting point if refolding is necessary .

How can researchers address the challenge of low RnfE expression levels?

To improve recombinant expression yields:

  • Codon optimization: Adjust codons to match E. coli preferences

  • Promoter selection: Test various promoter strengths (T7, tac, araBAD)

  • Induction optimization: Vary IPTG concentration, temperature, and induction timing

  • Host strain selection: Compare expression in different E. coli strains

  • Media optimization: Test enriched media formulations

  • Scale-up strategies: Consider high-density fermentation

A systematic optimization approach, testing multiple variables and quantifying protein yield at each step, will be necessary to achieve sufficient quantities for structural and functional studies.

How might cryo-electron microscopy advance our understanding of the RnfE complex structure?

Cryo-EM offers significant advantages for membrane protein structural studies:

  • Sample preparation: Requires less protein than crystallography (10-100 μg)

  • Native state visualization: Can capture different conformational states

  • Lipid environment preservation: Using nanodiscs or amphipols

  • Complex assembly visualization: Can resolve entire Rnf complex architecture

  • Resolution improvements: Recent advances allow near-atomic resolution

Researchers should prepare samples in detergent micelles, nanodiscs, or amphipols, with initial screening to identify optimal conditions before proceeding to high-resolution data collection.

What are the implications of RnfE in K. pneumoniae for developing narrow-spectrum antibiotics?

Exploring RnfE as an antibiotic target involves:

  • Essentiality assessment: Determine if rnfE is essential under infection-relevant conditions

  • Structural uniqueness analysis: Identify features distinct from human proteins

  • High-throughput screening: Develop assays suitable for compound library screening

  • In silico docking: If structure is available, perform virtual screening

  • Hit validation: Test promising compounds against various K. pneumoniae strains and human cell lines

This approach aligns with broader strategies targeting bacterial-specific processes to develop narrow-spectrum antibiotics with reduced impacts on the microbiome.

How do post-translational modifications affect RnfE function in K. pneumoniae?

Post-translational modifications might regulate RnfE activity:

  • Mass spectrometry analysis: To identify modifications (phosphorylation, acetylation, etc.)

  • Site-directed mutagenesis: Of predicted modification sites

  • Activity assays: Comparing modified versus unmodified protein

  • Modification-specific antibodies: To track modification states under different conditions

  • Inhibitor studies: Using drugs that target specific modification enzymes

This research direction could reveal dynamic regulation of electron transport in response to changing environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.