Recombinant Klebsiella pneumoniae Fumarate reductase subunit C (frdC)

What is the structural organization of frdC in Klebsiella pneumoniae?

Fumarate reductase subunit C (frdC) in K. pneumoniae strain 342 is a membrane-anchoring protein comprising 131 amino acids with a molecular mass of approximately 14.9 kDa . The protein belongs to the FrdC family and functions primarily in anchoring the catalytic components of the fumarate reductase complex to the cytoplasmic membrane . Based on studies of homologous proteins, frdC likely contains transmembrane domains that facilitate membrane integration, with specific residues oriented to interact with other subunits of the fumarate reductase complex. The complete amino acid sequence (MTTKRKPYVRPMTSTWWKKLPFYRFYMVREGTAVPTVWFSIVLIYGLFALKHGAESWAGYIGFLQNPVVVILNLITLAAALLHTKTWFELAPKAANVIIKGEKMGPEPVIKGLWVVTAVVTVVILFVALFW) provides the basis for structural prediction and functional analysis .

What differentiates frdC from other membrane-anchoring proteins in bacterial respiratory complexes?

The frdC protein belongs to the specific FrdC family and is distinguished by its role in the fumarate reductase complex . Unlike many other membrane-anchoring proteins, frdC likely contains sites for heme coordination, similar to what has been observed in other organisms where FrdC functions as a diheme cytochrome b . This heme coordination, possibly through conserved histidine residues, enables electron transfer functionality beyond mere structural anchoring. This dual structural-functional role distinguishes frdC from proteins that serve only as membrane anchors. Additionally, the specific interaction with menaquinone in the quinol binding site provides another unique characteristic of frdC compared to other membrane-anchoring proteins in different respiratory complexes.

What are the optimal expression systems for recombinant K. pneumoniae frdC production?

Based on recombinant protein production practices for similar membrane proteins, the expression of K. pneumoniae frdC can be optimized using several expression systems. E. coli remains the most accessible host, particularly strains specialized for membrane protein expression such as C41(DE3) or C43(DE3) . For enhanced expression, consider:

• Vector selection: pET series vectors with T7 promoter systems offer controllable, high-level expression

• Fusion tags: N-terminal His6 tags facilitate purification while minimally affecting function

• Growth conditions: Induction at lower temperatures (16-20°C) with reduced IPTG concentrations (0.1-0.5 mM) typically improves membrane protein folding

• Media formulation: Enriched media such as TB or 2YT generally yield higher biomass and protein production

For more complex studies requiring post-translational modifications, alternative expression platforms including yeast (Pichia pastoris) or baculovirus-infected insect cells may be advantageous . Selection of the appropriate expression system should consider downstream applications, required protein modifications, and the need for structural integrity of membrane-spanning regions.

What purification strategies are most effective for maintaining frdC structural integrity?

Purification of membrane proteins like frdC requires careful consideration to maintain native structure and function. An effective purification strategy includes:

• Membrane fraction isolation: Following cell disruption (typically by sonication or French press), differential centrifugation separates membrane fractions (30,000-100,000×g)

• Detergent selection: Mild detergents such as n-dodecyl-β-D-maltoside (DDM), n-decyl-β-D-maltoside (DM), or digitonin are preferred for solubilization

• Affinity chromatography: If His-tagged, immobilized metal affinity chromatography (IMAC) with controlled imidazole gradients (10-250 mM) minimizes non-specific binding

• Size exclusion chromatography: A polishing step using appropriate columns (Superdex 200) separates monomeric protein from aggregates

• Stability enhancement: Addition of glycerol (10-15%) and reducing agents (1-5 mM DTT or TCEP) helps maintain protein stability

Throughout purification, maintaining a controlled temperature (typically 4°C) and verifying protein integrity by activity assays are essential for ensuring functional recovery of recombinant frdC.

What methods are appropriate for assessing the functional activity of recombinant frdC?

Functional characterization of recombinant frdC requires assessment of both its membrane integration and its role in fumarate reduction. Recommended methods include:

• Membrane incorporation assays:

  • Fluorescence-based techniques using labeled phospholipids

  • Sucrose gradient ultracentrifugation to verify membrane association

  • Protease protection assays to determine topology

• Electron transport activity:

  • Spectrophotometric assays measuring the oxidation of reduced benzyl viologen coupled to fumarate reduction

  • Measurement of menaquinone oxidation in reconstituted proteoliposomes

  • Oxygen consumption assays in membrane preparations

• Protein-protein interaction studies:

  • Pull-down assays to verify interaction with FrdA and FrdB subunits

  • Crosslinking studies followed by mass spectrometry for interaction mapping

  • Microscale thermophoresis for quantitative binding assessments

By combining these approaches, researchers can comprehensively evaluate whether recombinant frdC properly incorporates into membranes and contributes to electron transport functionality.

How can site-directed mutagenesis of frdC inform structure-function relationships?

Site-directed mutagenesis represents a powerful approach for elucidating structure-function relationships in frdC. Based on studies of homologous proteins in Wolinella succinogenes, targeting histidine residues that potentially serve as heme ligands can provide critical insights . A comprehensive mutagenesis strategy should:

• Target conserved residues:

  • Predicted heme-coordinating histidines

  • Residues at the interface with other fumarate reductase subunits

  • Amino acids potentially involved in menaquinone binding

• Employ rational substitutions:

  • Conservative substitutions (e.g., His→Gln) to assess specific chemical contributions

  • Non-conservative changes (e.g., His→Ala) to completely eliminate side chain functionality

  • Introduction of cysteine residues for subsequent labeling studies

• Assess functional consequences through:

  • Growth phenotypes under anaerobic conditions with fumarate as terminal electron acceptor

  • Enzyme activity measurements in membrane preparations

  • Spectroscopic analysis of heme incorporation and properties

In Wolinella succinogenes, mutation of histidine residues (His44, His93, His143, and His182) resulted in loss of fumarate reductase activity and prevented growth with formate and fumarate, demonstrating their essential role in enzyme function . Similar strategic mutations in K. pneumoniae frdC would likely yield valuable insights into its functional mechanisms.

What is the relationship between frdC expression and antibiotic resistance in K. pneumoniae?

While direct evidence linking frdC to antibiotic resistance is not presented in the search results, several theoretical connections warrant investigation:

• Metabolic adaptation: Under antibiotic stress, K. pneumoniae may upregulate anaerobic respiratory pathways, including the fumarate reductase complex, to maintain energy production when aerobic respiration is compromised.

• Membrane composition: As a membrane protein, alterations in frdC expression could influence membrane permeability and potentially affect antibiotic penetration, especially for hydrophobic compounds.

• Persister cell formation: Metabolic shifts involving anaerobic respiration components have been implicated in persister cell formation, which exhibits enhanced antibiotic tolerance.

• Potential regulatory overlap: Regulatory networks controlling frdC expression may overlap with those governing resistance mechanisms, particularly in multidrug-resistant K. pneumoniae strains .

To investigate these potential relationships, researchers should consider:

• Transcriptomic and proteomic analyses comparing frdC expression between antibiotic-sensitive and resistant strains

• Gene knockout studies to assess whether frdC deletion affects minimum inhibitory concentrations

• Complementation experiments to determine if frdC overexpression alters antibiotic susceptibility profiles

These approaches would help clarify whether frdC plays a direct or indirect role in K. pneumoniae antibiotic resistance mechanisms.

How can structural biology approaches enhance our understanding of frdC function?

Advanced structural biology techniques can significantly enhance our understanding of frdC structure, dynamics, and interactions. An integrated structural biology approach should include:

• Cryo-electron microscopy (cryo-EM):

  • Single-particle analysis of the entire fumarate reductase complex

  • Subtomogram averaging to visualize the complex in membrane environments

  • Resolution of different conformational states during catalysis

• X-ray crystallography:

  • Crystallization trials using lipidic cubic phase for membrane proteins

  • Structure determination with molecular replacement using homologous structures

  • Analysis of substrate and inhibitor binding sites

• Nuclear magnetic resonance (NMR) spectroscopy:

  • Selective isotopic labeling for specific domain analysis

  • Solid-state NMR for membrane-embedded protein studies

  • Dynamics studies to identify flexible regions important for function

• Computational approaches:

  • Molecular dynamics simulations to study membrane insertion and protein dynamics

  • Homology modeling based on related structures from other organisms

  • Docking studies for understanding menaquinone interactions

Combined results from these methods would provide a comprehensive structural framework for understanding how frdC anchors the fumarate reductase complex in the membrane and facilitates electron transfer from menaquinone to the catalytic subunits.

How conserved is frdC across different Klebsiella species and other Enterobacteriaceae?

The conservation of frdC across Klebsiella species and related Enterobacteriaceae reflects both functional constraints and evolutionary adaptation. While specific comparative data for K. pneumoniae frdC is limited in the search results, analysis based on similar proteins suggests:

• Core functional domains:

  • Transmembrane regions are typically highly conserved due to constraints of membrane integration

  • Heme-binding sites, especially coordinating histidine residues, show strong conservation

  • Interface regions that interact with other fumarate reductase subunits maintain high sequence identity

• Variable regions:

  • Loop regions exposed to the periplasm or cytoplasm often exhibit greater sequence variation

  • Regions involved in species-specific regulation may show lower conservation

  • Menaquinone binding sites may vary to accommodate slight differences in quinone structure across species

Comparative genomic analysis would be valuable to establish:

• Presence of frdC homologs across various Klebsiella strains

• Correlation between sequence variations and ecological niches

• Potential horizontal gene transfer events affecting frdC distribution

Such evolutionary analysis provides context for functional studies and helps identify conserved residues that may be essential for function across bacterial species.

How does the structure-function relationship of K. pneumoniae frdC compare to homologs in model organisms?

Comparative analysis between K. pneumoniae frdC and well-studied homologs from model organisms reveals important insights into structure-function relationships. The following table summarizes key comparisons:

The W. succinogenes frdC has been extensively characterized, with mutagenesis studies demonstrating the essential role of histidine residues in heme coordination and enzyme function . These studies provide a valuable framework for investigating similar structure-function relationships in K. pneumoniae frdC. The absence of a second frdC paralog (frdC2) in K. pneumoniae, which was found non-essential in W. succinogenes, suggests potential differences in respiratory flexibility between these organisms .

How might frdC be exploited as a potential drug target in multidrug-resistant K. pneumoniae?

Fumarate reductase subunit C represents a potential novel drug target for addressing multidrug-resistant K. pneumoniae infections . Several characteristics make it appealing as a therapeutic target:

• Essential metabolic function: Inhibition of frdC could disrupt anaerobic respiration, potentially limiting bacterial survival in low-oxygen infection environments.

• Membrane localization: As a membrane protein, frdC might be accessible to drugs without requiring penetration into the bacterial cytoplasm.

• Absence in humans: The absence of direct homologs in human cells reduces the risk of off-target effects.

• Structural uniqueness: The specialized structure of frdC, particularly its heme binding sites, offers opportunities for selective targeting.

Research strategies to explore frdC as a drug target should include:

• High-throughput screening for compounds that specifically bind to or inhibit frdC

• Fragment-based drug discovery approaches focusing on the menaquinone binding site

• Structure-based drug design utilizing computational docking and molecular dynamics

• Development of peptidomimetics targeting protein-protein interfaces within the fumarate reductase complex

The rising prevalence of multidrug-resistant K. pneumoniae in hospital settings underscores the urgency of exploring such novel targets for antimicrobial development.

What approaches can be used to study frdC in the context of the complete fumarate reductase complex?

Understanding frdC within its native fumarate reductase complex requires integrated approaches that preserve protein-protein interactions and membrane context:

• Co-expression systems:

  • Polycistronic constructs expressing the complete frdCAB operon

  • Dual-vector systems with compatible origins of replication

  • Sequential induction systems for optimizing stoichiometry

• Native complex isolation:

  • Affinity tags on single subunits for pull-down of intact complexes

  • Gentle solubilization conditions preserving subunit interactions

  • Gradient ultracentrifugation for separating intact complexes

• Functional reconstitution:

  • Proteoliposome reconstitution with defined lipid compositions

  • Co-reconstitution with other respiratory chain components

  • Nanodiscs incorporation for single-molecule studies

• Advanced imaging:

  • Single-particle cryo-EM for high-resolution structural determination

  • Förster resonance energy transfer (FRET) for monitoring subunit interactions

  • Super-resolution microscopy for membrane distribution analysis

These approaches would provide a comprehensive understanding of how frdC functions within the context of the complete fumarate reductase complex, including its role in electron transfer, membrane anchoring, and potential interactions with other respiratory complexes.

How can genetic engineering of frdC contribute to enhanced metabolic engineering applications in K. pneumoniae?

Genetic engineering of frdC offers significant potential for metabolic engineering applications in K. pneumoniae, particularly for industrial biotechnology:

• Anaerobic production enhancement:

  • Optimizing electron flow through the fumarate reductase complex could improve yields of fermentation products like 1,3-propanediol

  • Balancing oxidation and reduction pathways through careful modulation of frdC expression

  • Creating variants with altered quinone specificity for redirected electron flow

• Integration with CRISPR-based technologies:

  • CRISPR-dCas9 systems demonstrated effectiveness for regulating gene expression in K. pneumoniae

  • Similar approaches could fine-tune frdC expression levels without complete knockout

  • Multiplexed regulation of frdC alongside other metabolic genes

• Pathway engineering strategies:

  • Creation of synthetic operons linking frdC expression to product pathways

  • Sensor-regulator systems that modulate frdC based on metabolic states

  • Compartmentalization approaches segregating electron transport functions

• Specific engineering targets:

  • Modifying heme coordination for altered redox potential

  • Engineering menaquinone binding sites for improved electron transfer

  • Altering membrane anchoring domains for optimized complex assembly

K. pneumoniae has already demonstrated utility in producing valuable compounds like 1,3-propanediol through metabolic engineering approaches . Strategic engineering of electron transport components like frdC could further enhance these capabilities by optimizing energy conservation during anaerobic metabolism.

What strategies can overcome difficulties in heterologous expression of frdC?

Membrane proteins like frdC frequently present challenges during heterologous expression. Effective troubleshooting strategies include:

• Address toxicity issues:

  • Utilize tight expression control with repressible promoters

  • Test multiple host strains (C41/C43, BL21-AI, Lemo21)

  • Reduce expression temperature to 16-20°C

  • Co-express with chaperones (GroEL/ES, DnaK/J)

• Optimize membrane integration:

  • Include signal sequences for proper targeting

  • Co-express with membrane integrase factors

  • Balance expression levels to prevent membrane overloading

  • Consider cell-free expression systems with supplied lipids

• Enhance protein stability:

  • Screen multiple detergents during solubilization

  • Add stabilizing ligands during expression

  • Create fusion constructs with stable protein partners

  • Test truncation constructs to identify stable domains

• Improve folding efficiency:

  • Incorporate rare codons for slower translation

  • Supplement with heme precursors for proper cofactor incorporation

  • Adjust induction timing to align with cell growth phase

  • Test disulfide isomerase co-expression for proteins with disulfide bonds

These approaches have proven effective for challenging membrane proteins and should be systematically tested to optimize heterologous expression of functional K. pneumoniae frdC.

How can researchers distinguish between functional and non-functional forms of recombinant frdC?

Distinguishing functional from non-functional recombinant frdC requires multiple complementary assessment approaches:

• Spectroscopic characterization:

  • UV-visible spectroscopy to confirm proper heme incorporation (characteristic peaks at ~410 nm and ~560 nm)

  • Circular dichroism to assess secondary structure elements

  • Fluorescence spectroscopy to evaluate tertiary structure integrity

• Functional assays:

  • Electron transfer activity using artificial electron donors/acceptors

  • Reconstitution with other fumarate reductase subunits to restore enzyme activity

  • Membrane potential generation in proteoliposomes

• Binding studies:

  • Isothermal titration calorimetry for menaquinone binding

  • Surface plasmon resonance for interaction with other subunits

  • Fluorescence quenching assays for ligand binding

• Structural analysis:

  • Size exclusion chromatography to assess oligomeric state

  • Limited proteolysis to evaluate proper folding

  • Thermal shift assays to determine stability

By combining these methods, researchers can comprehensively evaluate whether recombinant frdC maintains its native structure, cofactor binding, and functional capabilities, ensuring that experimental findings reflect physiologically relevant properties.

What role might frdC play in K. pneumoniae biofilm formation and persistence?

The potential involvement of frdC in K. pneumoniae biofilm formation and persistence represents an intriguing research direction with clinical relevance. Several aspects warrant investigation:

• Metabolic adaptation in biofilms:

  • Oxygen gradients within biofilms create microaerobic and anaerobic niches

  • Fumarate reductase activity could support growth in oxygen-limited biofilm regions

  • Altered electron transport chains may contribute to the metabolic heterogeneity characteristic of resilient biofilms

• Stress response connections:

  • Transitions between planktonic and biofilm states involve substantial metabolic remodeling

  • Anaerobic respiratory components like frdC might be differentially regulated during this transition

  • The electron transport chain composition could influence oxidative stress resistance in biofilms

• Experimental approaches:

  • Transcriptomic and proteomic profiling comparing frdC expression in planktonic versus biofilm cells

  • Fluorescent reporter fusions to monitor frdC expression within biofilm structures

  • Genetic knockout studies evaluating biofilm formation capacity and architecture

  • Confocal microscopy with respiratory activity indicators to map anaerobic respiration zones

Understanding frdC's role in biofilm metabolism could provide insights into persistent infections caused by multidrug-resistant K. pneumoniae and potentially identify new therapeutic approaches targeting biofilm-associated infections.

How might systems biology approaches enhance our understanding of frdC in the context of K. pneumoniae metabolism?

Systems biology offers powerful frameworks for understanding frdC within the broader metabolic and regulatory networks of K. pneumoniae: