Recombinant Klebsiella pneumoniae Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant K. pneumoniae frdD is a hydrophobic 13 kDa protein encoded by the frdD gene (Uniprot: A6TH70). It is part of the fumarate reductase complex, which transfers electrons from quinol or other donors to fumarate, enabling anaerobic respiration. The frdD subunit is essential for stabilizing the enzyme’s membrane-bound structure and facilitating electron transfer between subunits .

Research Applications

Recombinant frdD is primarily used in:

  1. Enzyme Activity Assays: Studying electron transfer kinetics or substrate specificity in vitro.

  2. Protein Interaction Studies: Identifying binding partners (e.g., quinol dehydrogenases, iron-sulfur clusters) using techniques like ELISA or co-IP .

  3. Immune Response Analysis: Investigating host-pathogen interactions, as FRD subunits may trigger immune responses during K. pneumoniae infections .

Production and Quality Control

The recombinant frdD is produced in E. coli via standard expression systems, purified to >95% homogeneity, and validated for endotoxin levels (<1.0 EU/µg) . Truncation or mutation studies (e.g., alanine substitutions) could disrupt its function, as seen in related FRD subunits .

Challenges and Future Directions

  • Limited Structural Data: No high-resolution crystallographic data for frdD is publicly available, limiting mechanistic insights.

  • Functional Redundancy: K. pneumoniae may compensate for frdD loss via alternative enzymes, as observed in other FRD subunits .

  • Therapeutic Targeting: FRD inhibitors could disrupt anaerobic metabolism in pathogens, but off-target effects on host enzymes (e.g., SDH) must be assessed .

This synthesis highlights the importance of frdD in bacterial metabolism and its potential as a research tool. Further studies are needed to elucidate its precise biochemical role and therapeutic implications.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. To request a specific tag, please inform us; we will prioritize its development.
Synonyms
frdD; KPK_5118; Fumarate reductase subunit D; Fumarate reductase 13 kDa hydrophobic protein; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Klebsiella pneumoniae (strain 342)
Target Names
frdD
Target Protein Sequence
MINPNPKRSDEPVFWGLFGAGGMWGAIVAPVMVLLVGILLPLGLAPADAFSYERVLAFAQ SFIGRAFIFLMIVLPLWCGLHRIHHAMHDLKIHVPNGKWVFYGLAAILSVITLVGVLFI
Uniprot No.

Target Background

Function
Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is utilized in anaerobic growth, while succinate dehydrogenase functions in aerobic growth. The FrdD subunit anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.
Database Links

KEGG: kpe:KPK_5118

Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of fumarate reductase in K. pneumoniae metabolism?

Fumarate reductase (FRD) in Klebsiella pneumoniae catalyzes the reduction of fumarate to succinate during anaerobic metabolism. Unlike the membrane-bound FRDs found in many bacteria, K. pneumoniae possesses a cytoplasmic soluble FRD that contains three prosthetic groups: noncovalently bound FMN and FAD plus a covalently bound FMN. This enzyme plays a critical role in anaerobic respiration by using NADH as an electron donor, allowing the bacterium to utilize fumarate as a terminal electron acceptor .

Research has demonstrated that FRD synthesis in K. pneumoniae is specifically induced only under anaerobic conditions in the presence of fumarate or malate, highlighting its specialized metabolic function . The fumarate reductase activity significantly exceeds its NADH dehydrogenase activity, with electron transfer between the noncovalently and covalently bound FMN moieties limiting catalytic turnover to approximately 10 reactions per second.

How does the fumarate reductase complex in K. pneumoniae differ from that in E. coli?

While the E. coli fumarate reductase is a well-characterized membrane-bound complex encoded by the frdABCD operon, the K. pneumoniae FRD appears to be a water-soluble, monomeric enzyme. The comparative structures are shown below:

FeatureE. coli FRDK. pneumoniae FRD
LocalizationMembrane-boundCytoplasmic, soluble
Subunit Structure4 subunits (FrdA, FrdB, FrdC, FrdD)Monomeric protein
Prosthetic GroupsIron-sulfur clustersThree flavins (noncovalent FMN, FAD, covalent FMN)
Electron DonorQuinolsNADH
Gene OrganizationfrdABCD operonGenes may not be in an operon arrangement
RegulationRegulated by oxygen, nitrate, fumarate, and FNRInduced only under anaerobic conditions with fumarate or malate

The E. coli FRD has FrdA as the catalytic subunit containing the active site, FrdB as an iron-sulfur subunit transferring electrons, and FrdC and FrdD serving as membrane anchor subunits that accept electrons from quinols . In contrast, the K. pneumoniae enzyme represents a novel type of water-soluble NADH:fumarate oxidoreductase with a different domain architecture .

What methodological approaches are used to express and purify recombinant frdD from K. pneumoniae?

For recombinant expression of K. pneumoniae proteins, including FRD subunits, researchers typically employ the following protocol:

  • Gene Cloning: The target gene (such as frdD) is amplified from genomic DNA using PCR with specific primers containing appropriate restriction sites.

  • Vector Construction: The amplified gene is cloned into an expression vector such as pET28a, which provides a His-tag for purification and can be used with a constitutive promoter (like P32) for continuous expression .

  • Expression System: Recombinant proteins from K. pneumoniae are commonly expressed in E. coli host strains like BL21(DE3), though yeast, baculovirus, or mammalian cell systems can also be used depending on the research requirements .

  • Protein Purification: Techniques include:

    • Affinity chromatography using Ni-NTA for His-tagged proteins

    • Ion-exchange chromatography

    • Size exclusion chromatography

    • Verification of purity by SDS-PAGE with a target of ≥85% purity

  • Functional Verification: Activity assays measuring the reduction of fumarate to succinate, often using NADH oxidation as a spectrophotometric readout at 340nm .

How can I investigate the specific contribution of frdD to K. pneumoniae virulence and pathogenesis?

To investigate the contribution of frdD to virulence, implement a multi-faceted experimental approach:

  • Gene Deletion Studies: Create an isogenic ΔfrdD mutant using the Lambda Red recombinase system as demonstrated for other K. pneumoniae genes . This involves:

    • Designing primers with homology to regions flanking the frdD gene

    • Amplifying an antibiotic resistance cassette with these primers

    • Transforming electrocompetent K. pneumoniae cells containing a modified pKD46 plasmid

    • Selecting transformants and confirming by colony PCR

  • Complementation: Create a complementation plasmid (e.g., based on pACYC184) containing the frdD gene with its native promoter to verify phenotypes are specifically due to the deletion .

  • In vivo Infection Models: Compare WT and ΔfrdD strains in:

    • Murine pneumonia model (using retropharyngeal inoculation)

    • Intestinal colonization model (via oral administration)

    • Bacteremia model (via intraperitoneal injection)

    • Use competition assays with 1:1 mixtures of WT and mutant strains to directly assess fitness differences

  • Organ-Specific Analysis: Collect lungs, spleen, liver, blood, and intestinal contents to quantify bacterial loads by selective plating .

  • Metabolic Profiling: As metabolic flexibility impacts bacterial fitness during infection, examine the growth of ΔfrdD mutants in:

    • Nutrient-limited conditions (minimal media)

    • Bronchioloalveolar lavage fluid

    • Human serum

    • Various carbon and nitrogen sources

  • Transcriptomic Analysis: Compare gene expression profiles between WT and ΔfrdD strains under aerobic and anaerobic conditions to identify compensatory pathways.

What techniques can be used to investigate the interactions between frdD and other components of the fumarate reductase complex?

To investigate interactions between frdD and other FRD components, employ these methodologies:

  • Co-immunoprecipitation (Co-IP): Using antibodies against frdD or tagged versions of frdD to pull down interaction partners.

  • Bacterial Two-Hybrid System: Fusion of frdD and potential interacting proteins to complementary fragments of adenylate cyclase to detect protein-protein interactions.

  • Domain Swap Experiments: Similar to the experiments performed with ApbE-like domains in Trypanosoma brucei FRD, create chimeric proteins with swapped domains between frdD and other subunits to assess functional implications .

  • Cross-linking Studies: Use chemical cross-linkers to capture transient protein-protein interactions followed by mass spectrometry analysis.

  • Surface Plasmon Resonance (SPR): Measure binding kinetics between purified frdD and other FRD components.

  • Cryo-Electron Microscopy: Determine the structural arrangement of the complete fumarate reductase complex and the positioning of frdD.

  • Site-Directed Mutagenesis: Identify critical residues in frdD by creating point mutations and assessing their impact on:

    • Complex assembly

    • Fumarate reductase activity

    • Anaerobic growth

How does oxygen availability affect the expression of frdD and what regulatory mechanisms control this?

Oxygen availability significantly impacts fumarate reductase expression through complex regulatory mechanisms:

  • Expression Patterns: Studies in E. coli show that the frdABCD operon expression increases 10-fold during anaerobic versus aerobic growth. In K. pneumoniae, FRD synthesis is specifically induced under anaerobic conditions in the presence of fumarate or malate .

  • The role of FNR regulator: The FNR protein (fumarate and nitrate reduction regulator) is a key transcriptional regulator that:

    • Acts as an oxygen sensor through its iron-sulfur cluster

    • Binds to specific DNA sequences in the promoter region of the frd operon

    • Activates transcription under anaerobic conditions

    • Research shows that fnr mutants exhibit greatly reduced expression of the frd operon

  • Alternative Electron Acceptors: Nitrate represses frd expression even in anaerobic conditions, establishing a hierarchy of preferred electron acceptors:

    Electron AcceptorRelative FRD ExpressionRedox Potential
    OxygenVery low+820 mV
    NitrateLow+420 mV
    FumarateHigh+30 mV
  • Experimental Analysis Methods:

    • Construct frdD-reporter gene fusions (e.g., frdD-lacZ) to quantify expression under various conditions

    • Perform quantitative RT-PCR to measure transcript levels

    • Use chromatin immunoprecipitation (ChIP) to identify regulatory protein binding sites

    • Analyze promoter regions through DNase footprinting and electrophoretic mobility shift assays (EMSA)

  • Research Considerations: When investigating regulation, control for:

    • Growth phase effects

    • Medium composition

    • Carbon source availability

    • Presence of other terminal electron acceptors

Can fumarate reductase subunits serve as targets for novel antimicrobial strategies against multidrug-resistant K. pneumoniae?

Fumarate reductase represents a potential antimicrobial target, particularly for addressing infections in anaerobic environments:

  • Rationale for Targeting FRD:

    • FRD is essential for anaerobic respiration using fumarate

    • Metabolic flexibility contributes to K. pneumoniae virulence in different host environments

    • The enzyme's structure differs from human enzymes, offering selective targeting potential

    • Metabolic enzymes represent an underexplored class of antimicrobial targets

  • Experimental Support:

    • Studies show that metabolic gene mutations like ΔgltA (citrate synthase) significantly reduce K. pneumoniae fitness during lung infection and intestinal colonization

    • Deletion of metabolic genes can create organ-specific fitness defects, suggesting pathway-specific targeting may reduce colonization at infection sites while minimizing disruption to commensal microbiota

  • Potential Approaches:

    • Small molecule inhibitors specifically designed against frdD or other FRD subunits

    • Peptide inhibitors that interfere with FRD complex assembly

    • RNA-based therapeutics targeting frdD mRNA

    • CRISPR-dCas9 systems to inhibit expression of FRD components (similar to approaches used for other K. pneumoniae genes)

  • Challenges to Consider:

    • Development of resistance through mutations or alternative metabolic pathways

    • Delivery of inhibitors to anaerobic infection sites

    • Potential off-target effects on commensal bacteria that also utilize fumarate reductase

    • Differential expression of FRD in various infection sites

How might alterations in frdD affect K. pneumoniae's metabolism and contribute to antibiotic resistance?

The connection between fumarate reductase, metabolic adaptation, and antibiotic resistance involves several mechanisms:

  • Metabolic Flexibility and Persistence:

    • Alterations in energy metabolism, including changes in FRD function, can lead to metabolic states that promote bacterial persistence

    • Persistent bacteria exhibit reduced susceptibility to antibiotics that target actively growing cells

    • Research shows metabolic adaptability is a key determinant of K. pneumoniae fitness in different host environments

  • Redox Balance Effects:

    • FRD plays a role in maintaining redox balance by oxidizing NADH under anaerobic conditions

    • Changes in redox status can affect the activity of some antibiotics, particularly those activated by reduction

    • Modified electron transport can lead to decreased membrane potential, reducing uptake of certain antibiotics

  • Biofilm Formation:

    • Metabolic enzymes can influence biofilm formation capacity

    • Biofilms significantly increase antibiotic resistance

    • Inhibition of biofilm formation through targeting recombinant K. pneumoniae proteins has been demonstrated as an effective strategy

  • Experimental Approaches:

    • Create frdD mutants and assess minimum inhibitory concentrations (MICs) for various antibiotic classes

    • Measure persister cell formation in wild-type versus frdD-modified strains

    • Evaluate biofilm formation capacity in anaerobic environments

    • Conduct metabolomic profiling to identify shifts in metabolic pathways that might contribute to resistance

What is the potential of recombinant frdD as a component in vaccine development against K. pneumoniae?

Recombinant subunit vaccines represent a promising strategy against K. pneumoniae infections, and frdD could potentially contribute to vaccine development:

  • Advantages of Targeting Metabolic Proteins:

    • Metabolic proteins like FRD subunits may be more conserved across K. pneumoniae strains compared to surface antigens

    • Conservation could provide broader protection against diverse strains, including both classical and hypervirulent lineages

    • Expression under specific conditions (anaerobic) might allow targeting of bacteria in particular infection niches

  • Subunit Vaccine Approaches:

    • Multi-epitope vaccines have shown success in K. pneumoniae, as demonstrated with the r-AK36 vaccine based on outer membrane proteins

    • A recombinant subunit vaccine containing frdD epitopes could be designed similarly

    • Data from r-AK36 shows approximately 80% survival in immunized mice challenged with 3× LD100 dose, suggesting the potential efficacy of this approach

  • Experimental Considerations:

    • Epitope mapping to identify immunogenic regions of frdD

    • Animal immunization studies with purified recombinant frdD

    • Assessment of humoral and cellular immune responses

    • Challenge studies to determine protective efficacy

    • Combination with other subunits or adjuvants to enhance immunogenicity

  • Potential Challenges:

    • Cytoplasmic proteins like FRD components may be less accessible to antibodies compared to surface antigens

    • Expression levels of FRD may vary between infection sites

    • Need to ensure the vaccine doesn't generate cross-reactivity with human proteins

    • The strain variability among K. pneumoniae isolates might affect conservation of frdD

How can recombinant K. pneumoniae FRD be used in biotechnological applications for succinate production?

Recombinant fumarate reductase from K. pneumoniae offers potential applications in sustainable chemical production:

  • Succinate as a Platform Chemical:

    • Succinate is a valuable platform chemical for producing biodegradable plastics, pharmaceuticals, and food additives

    • Biological production methods are sought as sustainable alternatives to petroleum-based processes

    • K. pneumoniae has already been engineered for the production of other chemicals like 1,3-propanediol and 3-hydroxypropionic acid

  • Advantages of Using K. pneumoniae FRD:

    • The soluble nature of K. pneumoniae FRD may offer advantages in industrial biocatalysis compared to membrane-bound enzymes

    • The enzyme's NADH-dependence allows coupling with other redox reactions in cell-free systems

    • Studies on K. pneumoniae metabolism have demonstrated its capacity for anaerobic production of valuable chemicals

  • Potential Engineering Approaches:

    • Overexpression of FRD components using constitutive promoters like P32

    • Optimization of cofactor regeneration systems for NADH

    • Integration with other metabolic pathways for complete conversion of renewable feedstocks

    • Application in cell-free enzymatic systems for direct conversion of fumarate to succinate

  • Experimental Results from Related Studies:

    • Engineering K. pneumoniae for 1,3-PDO production yielded 57.85 g/L in a 7.5L fermentation tank

    • Deletion of competing pathways (ΔdhaT) and overexpression of key enzymes can significantly improve product yields

    • CRISPR-dCas9 system has been successfully applied to regulate gene expression in K. pneumoniae for metabolic engineering

What methods can be used to enhance the stability and activity of recombinant frdD for research applications?

Optimizing the stability and activity of recombinant frdD for research applications involves several strategies:

  • Protein Engineering Approaches:

    • Site-directed mutagenesis to enhance stability without compromising function

    • Fusion tags that improve solubility (e.g., SUMO, MBP, or thioredoxin tags)

    • Disulfide bond engineering to stabilize tertiary structure

    • Consensus design based on sequence alignment of FRD subunits across bacterial species

  • Expression Optimization:

    • Codon optimization for the expression host

    • Testing various expression hosts (e.g., E. coli, yeast, or mammalian cells)

    • Expression temperature optimization (typically lower temperatures for improved folding)

    • Co-expression with chaperones to assist proper folding

    • Use of specialized E. coli strains for membrane/difficult proteins

  • Purification and Storage Considerations:

    • Optimized buffer composition based on stability screening

    • Addition of stabilizing agents:

      • Glycerol (typically 10-20%)

      • Reducing agents (DTT, β-mercaptoethanol)

      • Specific ions required for structural integrity

      • Mild detergents for hydrophobic regions

    • Lyophilization with appropriate cryoprotectants

    • Immobilization on suitable matrices for repeated use

  • Activity Preservation:

    • Identify and maintain critical cofactors (FAD, FMN)

    • Optimize redox environment to prevent oxidative damage

    • Storage in small aliquots to minimize freeze-thaw cycles

    • Consider enzyme kinetics when designing storage conditions

What are the challenges in expressing functional fumarate reductase complexes for structural studies?

Structural studies of fumarate reductase complexes face significant challenges:

  • Membrane Association Challenges:

    • While K. pneumoniae FRD appears to be soluble, many bacterial FRDs (like in E. coli) are membrane-associated, complicating expression and purification

    • The membrane anchor subunits (including frdD in membrane-bound FRDs) are often hydrophobic and difficult to express in soluble form

    • Detergent selection is critical for extracting and maintaining native conformation of membrane-associated components

  • Multi-Subunit Complex Assembly:

    • Ensuring proper assembly of all subunits in the correct stoichiometry

    • Maintaining cofactor incorporation (flavins, iron-sulfur clusters)

    • Co-expression strategies may be required to obtain fully assembled complexes

  • Oxygen Sensitivity:

    • FRD is normally expressed under anaerobic conditions

    • Iron-sulfur clusters (in some FRD variants) are oxygen-sensitive

    • Anaerobic preparation techniques are needed throughout purification and crystallization

  • Structural Techniques and Considerations:

    • X-ray crystallography challenges:

      • Obtaining diffraction-quality crystals of membrane proteins or large complexes

      • Phase determination for novel structures

    • Cryo-EM advantages:

      • Does not require crystallization

      • Can capture different conformational states

      • Increasingly capable of high-resolution structures

    • Sample preparation issues:

      • Protein concentration without aggregation

      • Maintaining enzymatic activity during preparation

      • Preserving native conformation in non-physiological conditions

  • Verification of Structural Relevance:

    • Confirming that structures represent functionally relevant states

    • Correlation of structural data with enzymatic activity

    • Validation through site-directed mutagenesis of key residues identified in the structure

How can comparative genomics of frdD across different K. pneumoniae strains inform our understanding of metabolic adaptation?

Comparative genomics of frdD across K. pneumoniae strains can provide insights into metabolic adaptation through:

  • Strain Diversity Analysis:

    • K. pneumoniae shows significant genomic diversity, with different species within the K. pneumoniae species complex (KpSC) and various lineages including classical and hypervirulent strains

    • Comparison of frdD sequences across this diversity can reveal:

      • Conservation levels indicating functional importance

      • Strain-specific variations that might correlate with niche adaptation

      • Evidence of horizontal gene transfer or recombination events

  • Clinical Isolate Characterization:

    • Analysis of frdD in clinical isolates from different infection sites can reveal:

      • Site-specific adaptations

      • Correlation with virulence or antibiotic resistance profiles

      • Studies have shown that metabolic genes like gltA influence fitness in specific infection sites

  • Methodology for Comparative Analysis:

    • Whole-genome sequencing of diverse isolates

    • Targeted PCR and sequencing of frdD from clinical collections

    • Phylogenetic analysis to determine evolutionary relationships

    • Structural modeling to predict functional impacts of variations

    • Correlation analysis with metadata (isolation site, patient outcomes, antibiotic resistance)

  • Research Findings from Related Studies:

    • Genomic studies have revealed hybrid strains between K. pneumoniae and K. variicola, demonstrating genetic exchange between species

    • Different K. pneumoniae strains show variability in metabolic capabilities, which influences their pathogenic potential

    • Recent studies identified distinct associations between genomic features and infection types:

      Genomic FeatureAssociationOdds Ratiop-value
      ESBLsNosocomial onset2.340.015
      Rhamnose+ capsulesNosocomial onset3.12<0.001
      ESBLsNosocomial transmission21<1×10⁻¹¹

What role might fumarate reductase play in K. pneumoniae's adaptation to the host gastrointestinal environment?

Fumarate reductase likely plays a significant role in K. pneumoniae's adaptation to the anaerobic gastrointestinal environment:

  • Gastrointestinal Colonization Factors:

    • The GI tract represents an anaerobic environment where alternative electron acceptors like fumarate are important

    • Recent research indicates that K. pneumoniae utilizes alternative nutrients to overcome colonization resistance in the gut

    • FRD would enable anaerobic respiration using fumarate as a terminal electron acceptor, providing an energetic advantage

  • Metabolic Flexibility in the Gut:

    • K. pneumoniae possesses diverse carbohydrate metabolism genes that help overcome colonization resistance

    • Studies show that the ability to utilize specific nutrients like fucose from mucins facilitates GI colonization

    • Anaerobic metabolism, including fumarate reduction, would be part of this metabolic flexibility

  • Competition with Gut Microbiota:

    • FRD may provide competitive advantages in the densely populated gut environment

    • Studies on ethanolamine metabolism show that specific metabolic capabilities enable K. pneumoniae to overcome colonization resistance and facilitate the spread of MDR clones

    • Similar mechanisms might apply to fumarate metabolism

  • Experimental Approaches to Investigate:

    • Create frdD deletion mutants and test intestinal colonization ability in mouse models

    • Compare gene expression of FRD components in fecal vs. respiratory isolates

    • Perform metabolomic analysis of K. pneumoniae growing in intestinal contents

    • Use in vivo competition assays between WT and frdD mutants in the GI tract

  • Research Implications:

    • Understanding the role of FRD in gut colonization could lead to targeted approaches to reduce carriage of multidrug-resistant strains

    • Since gut colonization often precedes infection, targeting FRD might be a preventative strategy

    • Metabolic interventions might offer alternatives to traditional antibiotics

How might cross-species comparison of fumarate reductase complexes inform evolutionary adaptation to different ecological niches?

Cross-species comparisons of fumarate reductase complexes provide valuable insights into evolutionary adaptation:

  • Structural and Functional Diversity:

    • FRD exists in different forms across microbial species:

      • Membrane-bound multi-subunit complexes (e.g., in E. coli)

      • Soluble monomeric enzymes (e.g., in K. pneumoniae)

      • Soluble multi-subunit enzymes (e.g., in Methanothermobacter thermoautotrophicus)

    • Different electron donors are utilized: quinols, NADH, FADH₂/FMNH₂, or coenzymes M and B

  • Evolutionary Implications:

    • The diversity of FRD structures suggests multiple independent evolutionary paths

    • Domain architecture analysis reveals:

      • Fusion events (e.g., ApbE-like domain in kinetoplastids)

      • Conservation of catalytic domains across diverse species

      • Adaptation of electron transfer modules to different metabolic contexts

  • Niche Adaptation Markers:

    • Thermophilic adaptations in Hydrogenobacter thermophilus FRD

    • Specialized expression patterns correlating with oxygen availability

    • Integration into different metabolic pathways:

      • Reductive TCA cycle in autotrophs

      • Anaerobic respiration in facultative anaerobes

      • Redox balance maintenance in various organisms

  • Research Methodologies:

    • Comparative genomic analysis across species

    • Phylogenetic studies to trace evolutionary relationships

    • Heterologous expression to study functional conservation

    • Biochemical characterization under different environmental conditions

    • Structural biology to compare three-dimensional architectures

  • Translational Insights:

    • Understanding of enzyme evolution can guide enzyme engineering efforts

    • Identification of conserved sites for broad-spectrum antimicrobial development

    • Recognition of unique adaptations that might be exploited for species-specific targeting

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.