Recombinant Klebsiella pneumoniae Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Klebsiella pneumoniae Large-Conductance Mechanosensitive Channel (MscL)

The mechanosensitive channel of large conductance (MscL) is a protein found in bacteria like Klebsiella pneumoniae and Actinobacillus pleuropneumoniae . MscL responds to mechanical stimuli, such as changes in membrane tension, which can occur due to osmotic stress or other environmental factors . Recombinant MscL is produced using genetic engineering techniques, often in Escherichia coli, to study its structure, function, and potential applications .

Function and Significance of MscL

MscL plays a crucial role in bacteria by acting as an emergency release valve when the cell experiences sudden changes in osmotic pressure . When osmotic pressure increases, the cell membrane stretches, activating MscL. This activation opens a channel through the membrane, allowing ions and small molecules to flow out of the cell, reducing the internal pressure and preventing cell lysis .

MscL's function extends beyond osmoregulation. Research indicates its involvement in antibiotic resistance, biofilm formation, and potentially, protein secretion . Targeting MscL may offer a strategy for developing new antibacterial compounds that increase bacterial specificity and decrease acquired resistance .

MscL in Klebsiella pneumoniae

Klebsiella pneumoniae is a bacterium that can cause pneumonia and other infections . Antibiotic-resistant strains of K. pneumoniae pose a significant challenge in clinical settings . Studies suggest MscL influences the bacterium's response to antibiotics and its ability to form biofilms, which contribute to its pathogenicity .

4.1. Role in Osmotic Adaptation and Antibiotic Resistance

MscL contributes to the ability of A. pleuropneumoniae to adapt to hyperosmotic conditions by regulating cell length . Deletion of mscL decreased the sensitivity of A. pleuropneumoniae to multiple antibiotics .

4.2. Impact on Biofilm Formation

MscL contributes to biofilm formation in A. pleuropneumoniae .

4.3. Mechanosensitive Channel Activation

Direct activation of MscL underlies the membrane permeabilization effect of certain antibacterial compounds .

4.4. MSC Therapy and Klebsiella pneumoniae

Mesenchymal stem cell (MSC) therapy can modulate the immune cell profile and enhance the resolution of lung injury induced by Klebsiella infection . Naive MSCs did not alter mRNA levels of collagen I or collagen VI compared to vehicle. Pre-activated UC-MSCs decreased collagen VI, and both pre-activated BM- and UC-MSCs decreased collagen I .

5.1. Impact of MSC Therapy on mRNA Concentrations

GeneNaive MSCsPre-activated BM-MSCsPre-activated UC-MSCs
Collagen INo changeDecreaseDecrease
Collagen VINo changeNo changeDecrease
ICAM-1DecreaseNo changeNo change
MPONo changeNo changeNo change

5.2. Effects of MSC Therapy on Alveolar Fluid

MeasurementNaive MSCsPre-activated MSCs
Neutrophil countNot significantly different from vehicle controlSignificantly higher than sham
Monocyte countNot significantly different from vehicle controlSignificantly higher than sham
ROS productionIncreasedNot significantly affected
Phagocytic index (BM-MSCs)UnchangedIncreased

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mscL; KPK_0425; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Klebsiella pneumoniae (strain 342)
Target Names
mscL
Target Protein Sequence
MSFLKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVT LRDAQGDVPAVVMHYGVFIQNVFDFIIVAFAIFMAIKLMNKLNRKKEEAPAAPPAPSKEE VLLSEIRDLLKEQNNRS
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces in the lipid bilayer. It is believed to play a role in regulating cellular osmotic pressure changes.
Database Links

KEGG: kpe:KPK_0425

Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.