Recombinant Klebsiella pneumoniae NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Key Features of Recombinant nuoK:

ParameterDetails
Amino Acid SequenceMIPLTHGLILAAILFVLGLTGLVIRRNLLFMLISLEIMINAAALAFVVAGSYWGQADGQI MYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSELRG (1–100 aa)
Molecular Weight~11 kDa (calculated from sequence)
Expression HostE. coli (commonly used for recombinant production)
TagN-terminal His-tag for purification
Purity>90% (SDS-PAGE verified)

Production and Handling

Recombinant nuoK is produced via heterologous expression in E. coli, followed by affinity chromatography purification. Commercial products are lyophilized or stored in Tris/PBS-based buffers with trehalose for stability .

Metabolic Engineering for Biofuel Production

Inactivation of NDH-1 (which includes nuoK) in K. pneumoniae increases intracellular NADH:NAD⁺ ratios, enhancing 2,3-butanediol biosynthesis. This strategy improved production by 46% (glycerol) and 62% (glucose) compared to wild-type strains .

Sodium Translocation Mechanism

nuoK is part of the membrane-bound segment of complex I, which translocates Na⁺ via an electroneutral Na⁺/electron symport ("electron loop" mechanism) . DCCD (dicyclohexylcarbodiimide) modification studies identified critical carboxyl groups in NuoH (a subunit adjacent to nuoK) that bind Na⁺, confirming its role in ion translocation .

Comparative Analysis of K. pneumoniae NQOs

EnzymeFunctionCationEnergy Conservation
NDH-1 (nuoK)NADH oxidation → quinone reductionNa⁺Yes
NDH-2NADH oxidation → quinone reductionNoneNo
NQRNADH oxidation → quinone reductionNa⁺No

Data synthesized from

Critical Research Gaps and Future Directions

  • Structural Insights: High-resolution crystallography of nuoK and adjacent subunits (e.g., NuoH) is needed to elucidate Na⁺ binding and electron transfer pathways.

  • Industrial Optimization: Metabolic engineering strategies targeting nuoK in K. pneumoniae warrant further exploration for scalable biofuel production .

  • Therapeutic Potential: The role of nuoK in pathogenicity or antibiotic resistance remains understudied.

Product Specs

Form
Lyophilized powder
Please note that we prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery information, please contact your local distributors.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; KPK_1480; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Klebsiella pneumoniae (strain 342)
Target Names
nuoK
Target Protein Sequence
MIPLTHGLILAAILFVLGLTGLVIRRNLLFMLISLEIMINAAALAFVVAGSYWGQADGQI MYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSELRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this particular species, the enzyme's immediate electron acceptor is believed to be ubiquinone. The reaction is coupled to proton translocation, where for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane, conserving the redox energy in a proton gradient.
Database Links

KEGG: kpe:KPK_1480

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the relationship between K. pneumoniae nuoK and bacterial pathogenicity?

NADH-quinone oxidoreductase subunit K (nuoK) is a membrane protein component of the bacterial respiratory chain complex I that plays a crucial role in energy metabolism. While not directly studied in the available literature for Klebsiella pneumoniae specifically, respiratory chain components like nuoK are generally essential for bacterial survival and can influence virulence by affecting energy production necessary for pathogenicity. Similar to how outer membrane proteins in K. pneumoniae have been investigated for their role in infection, respiratory chain components may contribute to the bacterium's ability to thrive in host environments . Research approaches should include gene knockout studies, virulence assays in animal models, and comparative analysis with other respiratory chain components.

What conservation patterns exist for nuoK across different Klebsiella strains?

Sequence conservation analysis of nuoK across Klebsiella strains would reveal evolutionary pressure on this protein. While specific conservation data for nuoK is not provided in the available literature, researchers can apply bioinformatics approaches similar to those used in identifying conserved outer membrane proteins in K. pneumoniae . This would involve collecting nuoK sequences from multiple Klebsiella strains, performing multiple sequence alignments, and calculating conservation scores for each amino acid position. Highly conserved regions often indicate functional importance, while variable regions might be involved in strain-specific adaptations.

What are optimal expression systems for recombinant K. pneumoniae nuoK?

For optimal expression of recombinant K. pneumoniae nuoK, consider the following methodological approach:

  • Expression system selection: As nuoK is a membrane protein, specialized expression systems designed for membrane proteins are recommended. E. coli C41(DE3) or C43(DE3) strains, which are engineered for membrane protein expression, should be evaluated alongside yeast systems like Pichia pastoris.

  • Vector design: Include affinity tags (His6 or Strep-II) at either the N- or C-terminus, separated by a TEV protease cleavage site for tag removal. Test both orientations to determine which affects function less.

  • Expression conditions: Systematically optimize temperature (16-30°C), inducer concentration (0.1-1.0 mM IPTG for E. coli systems), and expression duration (4-24 hours).

  • Verification method: Use Western blotting with anti-His antibodies and mass spectrometry to confirm expression.

This methodology draws from approaches used in membrane protein research, including those applied to K. pneumoniae outer membrane proteins , adapted specifically for respiratory chain components.

What purification strategies best maintain nuoK structural integrity?

For maintaining structural integrity during purification of recombinant nuoK:

  • Membrane extraction: Use mild detergents in a stepwise screening approach: test DDM (n-Dodecyl β-D-maltoside), LMNG (Lauryl Maltose Neopentyl Glycol), and digitonin at concentrations from 0.5-2%.

  • Purification steps:

    • Solubilize membranes in selected detergent

    • Perform initial purification via affinity chromatography (IMAC for His-tagged protein)

    • Include a size exclusion chromatography step

    • Consider lipid nanodisc reconstitution for long-term stability

  • Buffer optimization: Maintain pH 7.5-8.0 with 150-300 mM NaCl and include glycerol (10-20%) to prevent aggregation.

  • Stability assessment: Monitor using circular dichroism and thermal shift assays to ensure protein retains native folding.

This strategy integrates membrane protein purification techniques with specific considerations for respiratory chain components, drawing from methodological principles used in successful membrane protein research .

What functional assays can verify recombinant nuoK activity?

To verify the functional activity of recombinant nuoK:

  • Complex I activity measurement: Develop an NADH:ubiquinone oxidoreductase activity assay using artificial electron acceptors like decylubiquinone or coenzyme Q1. Monitor NADH oxidation spectrophotometrically at 340 nm.

  • Proton pumping assays: Reconstitute purified nuoK or whole complex I into liposomes containing pH-sensitive fluorescent dyes (ACMA or pyranine) to measure proton translocation.

  • Complementation studies: Develop a nuoK-knockout strain of K. pneumoniae and assess whether recombinant nuoK can restore respiratory function.

  • Binding assays: Evaluate interaction with other complex I subunits using pull-down assays, surface plasmon resonance, or isothermal titration calorimetry.

This approach combines enzymatic activity measurements with functional complementation strategies, similar to immunological assessment methods used for validating K. pneumoniae proteins in previous studies .

How can I investigate nuoK's role in antibiotic resistance mechanisms?

To investigate nuoK's potential role in antibiotic resistance:

  • Generate nuoK knockdown/knockout strains: Use CRISPR-Cas9 or homologous recombination techniques to create nuoK-deficient K. pneumoniae strains.

  • Antibiotic susceptibility testing: Perform minimum inhibitory concentration (MIC) determinations comparing wild-type and nuoK-modified strains against multiple antibiotic classes.

  • Metabolic analysis: Measure changes in ATP production, membrane potential, and NADH/NAD+ ratio in response to antibiotic stress.

  • Transcriptomic profiling: Perform RNA-seq on wild-type and nuoK-modified strains under antibiotic stress to identify compensatory mechanisms.

  • Resistance development rates: Compare the rate of resistance acquisition between wild-type and nuoK-modified strains under antibiotic selective pressure.

This methodological framework adapts approaches from both proteomic studies of K. pneumoniae and antibiotic resistance research, focusing specifically on respiratory chain components as potential resistance factors.

What structural biology techniques are most informative for studying nuoK?

For structural characterization of nuoK:

  • Cryo-electron microscopy (cryo-EM): Most suitable for membrane proteins like nuoK, especially as part of the larger complex I. Sample preparation involves purifying the entire complex or reconstituting nuoK into nanodiscs.

  • X-ray crystallography: Challenging but possible through:

    • Lipidic cubic phase crystallization

    • Co-crystallization with antibody fragments

    • Use of fusion partners to enhance crystallization

  • NMR spectroscopy: For dynamics studies, use selective isotopic labeling (15N, 13C) of nuoK and collect 2D and 3D spectra in detergent micelles or nanodiscs.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To map solvent-accessible regions and conformational changes upon interaction with other subunits.

  • Molecular dynamics simulations: Complement experimental data with simulations of nuoK in a lipid bilayer environment.

This multi-technique approach integrates modern structural biology methods specifically adapted for challenging membrane proteins, building upon proteomics and bioinformatics strategies used in K. pneumoniae protein research .

How does nuoK contribute to K. pneumoniae bioenergetics under different environmental conditions?

To investigate nuoK's role in bioenergetics adaptation:

  • Environmental stress studies: Examine nuoK expression and complex I activity under:

    • Oxygen limitation (microaerobic/anaerobic conditions)

    • pH stress (acidic/alkaline environments)

    • Nutrient limitation

    • Host-mimicking conditions (serum, macrophage interaction)

  • Metabolic flux analysis: Use 13C-labeled substrates to trace carbon flow through central metabolic pathways in wild-type versus nuoK-modified strains.

  • Bioenergetic measurements: Quantify:

    • ATP production rates

    • NAD+/NADH ratios

    • Membrane potential (using fluorescent probes)

    • Oxygen consumption rates

  • Comparative analysis: Create a dataset comparing bioenergetic parameters across environmental conditions to identify conditions where nuoK function is most critical.

This research strategy combines classical bioenergetics measurements with modern metabolic analysis techniques, drawing inspiration from immune response studies of K. pneumoniae proteins that examined environmental adaptation .

How can I resolve contradictory findings about nuoK function in the literature?

To systematically resolve contradictions in nuoK research findings:

  • Systematic categorization:

    • Create a structured database documenting experimental conditions, methodologies, and findings

    • Identify variables that differ between contradictory studies (strain differences, experimental methods, environmental conditions)

  • Replication with controls:

    • Design experiments that simultaneously test contradictory findings under identical conditions

    • Include positive and negative controls to validate experimental systems

  • Meta-analysis approach:

    • Apply statistical methods to evaluate the strength of evidence for competing hypotheses

    • Assess publication bias using funnel plot analysis

  • Consistency assessment:

    • Apply contradiction detection methods similar to those developed for clinical literature

    • Use distant supervision approaches to identify potentially conflicting claims

This methodological framework draws from clinical contradiction detection techniques , adapting them specifically for resolving conflicts in basic science research on bacterial proteins.

What statistical approaches are most appropriate for analyzing nuoK mutational studies?

For statistical analysis of nuoK mutational studies:

  • Experimental design considerations:

    • Implement factorial designs to assess interactions between mutations

    • Use appropriate controls (wild-type, known inactive mutants)

    • Ensure adequate biological and technical replication (minimum n=3)

  • Statistical methods selection:

    Analysis GoalRecommended Statistical ApproachImplementation
    Single mutation effectsOne-way ANOVA with post-hoc testsCompare activity of each mutant to wild-type
    Multiple mutation interactionsTwo-way ANOVA or linear regression modelsIdentify synergistic or antagonistic effects
    Structure-function relationshipsPrincipal Component AnalysisGroup mutations by functional impact
    Evolutionary conservation correlationPearson/Spearman correlationCorrelate conservation scores with functional effects
  • Addressing heterogeneity:

    • Implement mixed-effects models to account for batch effects

    • Use bootstrapping for robust confidence intervals

    • Apply Bayesian approaches for complex datasets

These statistical approaches have been adapted from contradiction detection methodologies in medical literature , tailored specifically for protein mutational analysis.

How can I integrate proteomics and genomics data in nuoK research?

For integrated multi-omics analysis of nuoK:

  • Data collection strategy:

    • Perform parallel genomic (DNA-seq), transcriptomic (RNA-seq), and proteomic (LC-MS/MS) analyses

    • Include wild-type and nuoK-modified strains under multiple conditions

    • Collect metadata on experimental conditions and phenotypes

  • Integration methodology:

    • Implement network analysis using protein-protein interaction data

    • Apply machine learning algorithms (random forest, support vector machines) to identify patterns across omics layers

    • Use pathway enrichment analysis to contextualize findings

  • Visualization techniques:

    • Develop multi-layer networks showing genomic, transcriptomic, and proteomic changes

    • Create heat maps for condition-specific responses

    • Implement Sankey diagrams to visualize flux through metabolic pathways

  • Contradiction resolution:

    • Apply clinical contradiction detection principles to identify discrepancies between omics layers

    • Use ontology-driven approaches to normalize terminology across datasets

This integrated approach combines proteomics methods used in K. pneumoniae research with contradiction detection methodologies , creating a comprehensive framework for multi-omics data integration.

How can nonhomologous random recombination be applied to engineer novel nuoK variants?

To apply nonhomologous random recombination (NRR) for nuoK engineering:

  • Library generation protocol:

    • Fragment nuoK gene using DNase I digestion or mechanical shearing

    • Reassemble fragments using DNA polymerase without sequence homology requirements

    • Clone libraries into expression vectors with appropriate selection markers

  • Selection strategy development:

    • Design a growth-based selection system where nuoK function is essential

    • Implement biochemical screening assays to identify variants with enhanced properties

    • Use deep sequencing to track library diversity

  • Functional characterization:

    • Analyze kinetic parameters of promising variants

    • Perform structural studies to understand the basis for altered function

    • Assess stability and expression levels relative to wild-type

  • Iterative improvement:

    • Subject best-performing variants to additional rounds of NRR

    • Combine beneficial mutations through DNA shuffling

    • Apply focused mutagenesis to refine promising regions

This methodology adapts the NRR approach described in the literature for nucleic acid evolution , applying it specifically to bacterial respiratory chain components like nuoK.

What are the implications of nuoK research for developing novel antimicrobials?

For antimicrobial development targeting nuoK:

  • Target validation strategy:

    • Confirm essentiality of nuoK across clinically relevant Klebsiella strains

    • Determine conservation of potential binding sites

    • Assess impact of nuoK inhibition on bacterial fitness in infection models

  • Screening approach:

    • Develop high-throughput assays for complex I activity

    • Design focused libraries targeting membrane protein interactions

    • Implement fragment-based drug discovery approaches

  • Medicinal chemistry considerations:

    • Optimize compounds for penetration of bacterial outer membrane

    • Balance inhibitory potency with selectivity over mammalian complex I

    • Consider structure-based design using homology models

  • Resistance development assessment:

    • Evaluate frequency of resistance emergence

    • Characterize resistance mechanisms through whole genome sequencing

    • Implement strategies to counter anticipated resistance

This research direction builds upon the understanding of K. pneumoniae pathogenesis from vaccine development studies , redirecting the focus toward respiratory chain components as antimicrobial targets.

How can I establish collaborations for comprehensive nuoK characterization?

To establish productive collaborations for nuoK research:

  • Collaboration framework:

    • Identify complementary expertise needs (structural biology, bioenergetics, molecular dynamics)

    • Develop clear data sharing protocols and authorship agreements

    • Establish regular communication channels and progress reporting

  • Resource sharing strategy:

    • Create repositories for strains, plasmids, and protocols

    • Implement standardized experimental conditions across laboratories

    • Develop shared databases for experimental results

  • Technology integration plan:

    • Combine spectroscopic, structural, and functional approaches

    • Integrate computational modeling with experimental validation

    • Develop data analysis pipelines that accommodate diverse data types

  • Contradiction management:

    • Implement protocols for verifying contradictory results across laboratories

    • Use methods similar to clinical contradiction detection to identify potential experimental inconsistencies

    • Develop consensus procedures for resolving methodological differences

This collaborative approach integrates concepts from clinical contradiction detection and proteomics research , creating a framework specifically designed for coordinating complex membrane protein studies across multiple research groups.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.