Recombinant Klebsiella pneumoniae p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Klebsiella pneumoniae p-Hydroxybenzoic Acid Efflux Pump Subunit AaeA (aaeA)

Recombinant Klebsiella pneumoniae p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA) is a protein involved in the efflux of p-hydroxybenzoic acid in Klebsiella pneumoniae . AaeA, also known as pHBA efflux pump protein A, is a subunit of an efflux pump that helps the bacterium to resist certain toxic compounds .

Characteristics

AaeA is a protein that is expressed by Klebsiella pneumoniae . It has a molecular weight of approximately 29 kDa . The protein is produced using a recombinant E. coli expression system, where the gene encoding Met1-Phe264 is expressed .

Key Properties of Recombinant Klebsiella pneumoniae AaeA:

PropertyDescription
Product NameKlebsiella pneumoniae NEO Recombinant Protein (RPES3535)
Product CodeRPES3535
Size10µg
SpeciesKlebsiella pneumoniae
Expressed HostE. coli
SynonymsAminoglycoside 3'-phosphotransferase, APH(3')-II, APH(3')II, Kanamycin kinase type II, Neomycin-kanamycin phosphotransferase type II, neo
AccessionP00552
SequenceMet1-Phe264
Endotoxin<1.0 EU per µg (determined by the LAL method)
Protein ConstructionRecombinant Klebsiella pneumoniae NEO is produced by our E.coli expression system and the target gene encoding Met1-Phe264 is expressed .
Purity> 95% as determined by reducing SDS-PAGE
Mol Mass29 kDa
AP Mol Mass28-30 kDa
FormulationSupplied as a 0.2 µm filtered solution of PBS, pH 7.4, 20% Glycerol
Stability and StorageStore at < -20°C, stable for 6 months. Please minimize freeze-thaw cycles .

Function and Role

AaeA functions as a subunit of the p-hydroxybenzoic acid efflux pump in K. pneumoniae . Efflux pumps are crucial for bacterial resistance as they actively transport toxic substances, including antibiotics, out of the cell .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your reconstitution.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. To prioritize a specific tag type, please inform us during your order.
Synonyms
aaeA; KPK_0468; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Klebsiella pneumoniae (strain 342)
Target Names
aaeA
Target Protein Sequence
MKTLTRNILRTAITVILVILAFVAIFRAWVYYTASPWTRDARFSADIVAIAPDVSGLISQ VNVKDNQLVKKDQVLFVIDQPRYQKALAEAEADVAYYQTLAQEKRVEAGRRNKLGIQAMS REEIDQANNVLQTVEHQLAKAVASRDLARLDLERTEIRAPADGWVTNLNVYTGEFITRGS TAVALVKENTFYVMAYLEETKLEGVRPGYRAEITPLGSSKTIKGTVDSIAAGVTNASSSS DSKGMASVDSNLEWVRLAQRVPVRIRLDQQQGNLWPSGTTATVVITGKEDRDTSRANFFQ KLAMRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links

KEGG: kpe:KPK_0468

Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the AaeA efflux pump subunit and how does it function in Klebsiella pneumoniae?

AaeA functions as a membrane fusion protein component of the p-hydroxybenzoic acid efflux pump system in K. pneumoniae. Based on homologous systems characterized in Escherichia coli, AaeA (previously designated yhcQ) works in conjunction with AaeB (yhcP) to form a functional efflux pump that exports aromatic carboxylic acids, particularly p-hydroxybenzoic acid (pHBA) . This efflux system belongs to the family of energy-dependent transporters that enable bacteria to extrude toxic compounds, including metabolic byproducts and antimicrobial agents. While most extensively studied in E. coli, similar efflux mechanisms exist in K. pneumoniae, where they contribute to both metabolic homeostasis and antimicrobial resistance.

How is the aaeA gene regulated in K. pneumoniae?

The regulation of aaeA in K. pneumoniae likely follows patterns similar to those observed in related Enterobacteriaceae. In E. coli, aaeA expression is controlled by an upstream, divergently transcribed regulator belonging to the LysR family (renamed from yhcS to aaeR) . This regulator responds to the presence of aromatic carboxylic acids, which serve as inducers for the expression of the aaeA gene. K. pneumoniae possesses various transcriptional regulators, including SoxS, RamA, MarA, and Rob, which are known to regulate efflux pump expression . Additionally, the novel AraC-type regulator RarA has been identified in K. pneumoniae genomes and may influence efflux pump expression . The expression of efflux pump components is often upregulated in response to environmental stressors, particularly antimicrobial compounds.

What is the physiological role of the AaeAB efflux system in bacterial metabolism?

The AaeAB efflux system appears to function as a "metabolic relief valve" that alleviates toxic effects of imbalanced metabolism . P-hydroxybenzoic acid is a metabolic intermediate in several biochemical pathways, and its accumulation can be detrimental to bacterial cells. The highly regulated expression of the AaeAB system suggests it plays a crucial role in maintaining cellular homeostasis by preventing the buildup of toxic metabolites . This differs somewhat from broader-spectrum efflux pumps like AcrAB, which contribute significantly to antimicrobial resistance across multiple antibiotic classes . The physiological function of AaeAB may be more specialized for specific aromatic carboxylic acids, as demonstrated by the limited substrate profile observed in experimental studies of the E. coli homolog .

How does AaeA structure compare with other membrane fusion proteins in multidrug resistance efflux systems?

While specific structural data for K. pneumoniae AaeA is limited, membrane fusion proteins (MFPs) like AaeA share common structural features that enable them to bridge the inner membrane transporter (AaeB) with outer membrane components. Unlike the well-characterized AcrA MFP from the AcrAB-TolC system, which interacts with TolC to form a continuous channel across both membranes, the AaeA protein likely has structural adaptations specific to aromatic carboxylic acid efflux .

AaeA belongs to the membrane fusion protein family that typically contains an α-helical coiled-coil domain responsible for interactions with outer membrane components, and a membrane proximal domain that interfaces with the inner membrane transporter . Studies of the AcrAB system in K. pneumoniae have shown that disruption of the efflux pump components leads to increased susceptibility to antimicrobial agents, suggesting critical structural interactions required for functional efflux activity .

What experimental approaches are most effective for expressing and purifying recombinant K. pneumoniae AaeA?

Effective expression and purification of recombinant K. pneumoniae AaeA requires strategies that address the challenges of membrane-associated protein production. The most successful approaches include:

  • Expression system selection: E. coli BL21(DE3) derivatives like C41(DE3) or C43(DE3) are preferred for membrane protein expression due to their tolerance for toxic proteins.

  • Vector optimization: Using vectors with tightly regulated promoters (e.g., T7lac) and fusion tags that enhance solubility (MBP, SUMO) significantly improves yield.

  • Membrane extraction protocol: A two-step solubilization process using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) preserves protein structure and function.

  • Purification strategy: Immobilized metal affinity chromatography followed by size exclusion chromatography typically yields the highest purity.

Experimental studies with other membrane fusion proteins have demonstrated that maintaining the native conformation during purification is critical for functional studies . The AaeA protein likely requires similar careful handling to preserve its ability to interact with AaeB and other potential efflux system components.

How do mutations in AaeA affect efflux pump efficiency and antimicrobial resistance profiles?

Mutations in membrane fusion proteins like AaeA can significantly alter efflux pump efficiency through several mechanisms. Based on studies of analogous systems such as AcrAB in K. pneumoniae, mutations affecting the following functional aspects would be most critical:

  • Protein-protein interaction domains: Mutations in regions responsible for AaeA-AaeB interactions could disrupt pump assembly, leading to complete loss of efflux function .

  • Conformational flexibility: Many MFPs undergo conformational changes during the transport cycle; mutations affecting this flexibility would impair efflux efficiency.

  • Substrate specificity determinants: Alterations in substrate-interacting regions might change the spectrum of compounds transported.

The AcrB knockout studies in K. pneumoniae demonstrated increased susceptibility to multiple antimicrobial agents, including β-lactams and quinolones, highlighting the critical role of properly functioning efflux systems in antimicrobial resistance . Similar effects would likely be observed with defective AaeA mutants, particularly regarding resistance to aromatic carboxylic acid compounds.

What functional assays can be used to characterize the activity of recombinant AaeA in reconstituted systems?

Several functional assays can effectively characterize recombinant AaeA activity:

Assay TypeMethodologyKey ParametersAdvantagesLimitations
Fluorescent substrate effluxReal-time monitoring of fluorescent substrate accumulation/effluxEfflux rate (min⁻¹); Maximum efflux capacityDirect measurement of transport kineticsLimited to fluorescent substrates
Growth inhibition assaysMIC determination with pHBA in wild-type vs. AaeA-deficient strainsIC₅₀ values; Fold-change in susceptibilitySimple setup; Physiologically relevantIndirect measure of efflux activity
Membrane vesicle transportInside-out vesicles loaded with substratesInitial transport rate; Energy dependenceIsolated system without cellular complexitiesComplex preparation; Potential artifacts
Surface plasmon resonanceAaeA-AaeB interaction kineticsK₀n, K₀ff, and Kd valuesDirect measurement of protein interactionsRequires purified, functional proteins

The effectiveness of these assays has been demonstrated in studies of the AcrAB efflux system, where functional characterization revealed roles in both antimicrobial resistance and virulence . Similar approaches would be applicable to the AaeA protein to determine its specific contribution to p-hydroxybenzoic acid efflux and potential roles in broader resistance phenotypes.

How can gene knockout and complementation strategies be optimized for studying AaeA function in K. pneumoniae?

Effective genetic manipulation strategies for studying AaeA function include:

  • Precise gene deletion methods: CRISPR-Cas9 or λ-Red recombineering systems allow for scarless deletion of aaeA without polar effects on adjacent genes. This approach was successfully used for creating AcrB knockouts in K. pneumoniae strain 52145R to study efflux pump contributions to antimicrobial resistance and virulence .

  • Complementation constructs: Plasmid-based complementation should employ vectors with native-like expression levels. Studies with AcrAB demonstrated that both AcrA and AcrB expression were necessary for restoring the wild-type phenotype .

  • Conditional expression systems: Inducible promoters permit tight control of aaeA expression for dose-response studies.

  • Chromosomal integration: Single-copy integration of aaeA variants at neutral loci allows for physiologically relevant expression levels.

When implementing these strategies, careful validation is essential. Phenotypic assays should include susceptibility testing to p-hydroxybenzoic acid and other potential substrates, similar to the approach used to demonstrate hypersensitivity to pHBA in yhcP (aaeB) mutants in E. coli . Additionally, transcriptional analysis of the aaeA operon under various conditions would provide insights into its regulation in K. pneumoniae.

What approaches can be used to investigate AaeA's contribution to K. pneumoniae virulence and pathogenesis?

Investigating AaeA's contribution to virulence requires multi-faceted approaches:

  • Infection models: Murine pneumonia models have successfully demonstrated the contribution of the AcrAB efflux system to K. pneumoniae virulence . Similar models could assess whether AaeA affects colonization, persistence, or tissue damage.

  • Innate immune response interactions: Testing susceptibility of aaeA mutants to antimicrobial peptides and bronchoalveolar lavage fluid components, as performed with AcrB knockouts , would reveal potential roles in immune evasion.

  • Biofilm formation assessment: Crystal violet assays can quantify biofilm formation capacity of wild-type versus aaeA-deficient strains, similar to methods used to evaluate the antibiofilm activity of plant extracts against K. pneumoniae .

  • Transcriptional profiling: RNA-seq analysis comparing wild-type and aaeA mutants during infection would identify affected virulence pathways.

  • Virulence gene expression: PCR-based detection of virulence genes (similar to assessment of K1, OmpK35, FimH, and RmpA in clinical isolates ) would determine if AaeA affects virulence gene expression.

The AcrAB efflux system has demonstrated roles beyond antimicrobial resistance, serving as a virulence factor that enables K. pneumoniae to resist innate immune defenses . Investigation of AaeA should similarly consider its potential multifunctional nature in pathogenesis.

How might AaeA interact with other efflux systems in multi-drug resistant K. pneumoniae strains?

In multidrug-resistant K. pneumoniae, efflux systems likely operate in complex networks with functional overlap and potential interactions. The AaeA protein may interact with broader resistance mechanisms in several ways:

  • Regulatory network overlap: Transcriptional regulators like RarA, RamA, SoxS, and MarA can affect expression of multiple efflux systems simultaneously . Evidence suggests these regulators influence antimicrobial resistance profiles through coordinated expression of different efflux components.

  • Functional redundancy: When the primary efflux systems (like AcrAB) are disrupted or overwhelmed, specialized pumps like AaeAB may compensate by exporting a subset of compounds. This redundancy contributes to the robustness of resistance mechanisms.

  • Shared outer membrane components: Many efflux systems utilize common outer membrane components like TolC. The presence of TolC in most K. pneumoniae isolates (as noted in clinical studies ) indicates its importance in efflux function across different pump systems.

Research on AcrAB has demonstrated its significant contribution to multidrug resistance in K. pneumoniae , while studies on regulatory proteins like RarA have shown their ability to influence resistance profiles . Understanding how specialized pumps like AaeAB interact with these systems would provide insights into the complex resistance mechanisms in clinical isolates.

What is the potential for inhibitors targeting AaeA as adjuvants in antimicrobial therapy?

The development of AaeA inhibitors as therapeutic adjuvants presents both opportunities and challenges:

Potential BenefitsDevelopment ConsiderationsEfficacy Markers
Enhanced efficacy of aromatic carboxylic acid-based antimicrobialsSelectivity for bacterial vs. human transportersReduction in MIC values of antibiotics
Reduced emergence of resistance to combination therapiesBioavailability in infection sites (particularly lungs for K. pneumoniae pneumonia)Restored susceptibility in resistant isolates
Potential attenuation of virulenceChemical stability and pharmacokinetic propertiesReduced bacterial survival in infection models
Novel mechanism distinct from existing adjuvantsPotential for cross-resistance through upregulation of alternative efflux systemsSynergy coefficients with existing antibiotics

The success of this approach would depend on understanding the specific contributions of AaeA to antimicrobial resistance. Studies of AcrAB have shown that efflux pump inhibition can restore susceptibility to multiple antimicrobial classes , suggesting similar strategies might be effective against specialized systems like AaeAB.

How do environmental conditions affect AaeA expression and function in K. pneumoniae?

Environmental factors likely influence AaeA expression and function through multiple mechanisms:

  • Aromatic compound exposure: Similar to E. coli, where pHBA and other aromatic carboxylic acids induce yhcRQP (aaeXAB) expression , K. pneumoniae probably upregulates aaeA in response to specific substrate exposure.

  • Stress response integration: Antimicrobial exposure triggers complex stress responses affecting multiple efflux systems. Studies of AcrAB regulation in K. pneumoniae have revealed connections between stress response and efflux upregulation .

  • Host environment adaptation: The lung environment during pneumonia contains antimicrobial peptides and other defense molecules that may induce efflux pump expression. The AcrAB system has been shown to contribute to K. pneumoniae's ability to resist these host defenses .

  • Biofilm-specific regulation: Environmental conditions promoting biofilm formation may alter the expression patterns of efflux components, affecting both antimicrobial resistance and cellular metabolism within the biofilm structure.

Understanding these environmental influences would provide insights into the ecological and pathogenic contexts in which AaeA functions, potentially revealing new approaches to combat antimicrobial resistance in K. pneumoniae.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.