Recombinant Klebsiella pneumoniae Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Introduction to Klebsiella pneumoniae and the ArnE Protein

The ArnE protein represents one subunit of a critical membrane protein complex in K. pneumoniae that contributes to antimicrobial resistance. Specifically, ArnE functions as a subunit of the 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase, an enzyme complex that plays a crucial role in lipopolysaccharide (LPS) modification .

Genetic Organization and Structure of the Arn Operon

The ArnE protein is encoded by the arnE gene, which is part of the arn operon in K. pneumoniae. This operon contains seven genes encoding enzymes responsible for the modification of bacterial outer membrane lipopolysaccharide with the cationic L-Ara4N (4-amino-4-deoxy-L-arabinose) moiety . The complete operon structure includes:

GeneProtein ProductFunction
arnBArnBAminotransferase
arnCArnCGlycosyltransferase
arnAArnABifunctional enzyme (decarboxylase/formyltransferase)
arnDArnDL-Ara4N biosynthesis
arnTArnTTransferase
arnEArnEL-Ara4N-phosphoundecaprenol flippase subunit
arnFArnFL-Ara4N-phosphoundecaprenol flippase subunit

The ArnE and ArnF proteins together form a heterodimeric flippase that is responsible for translocating the modified L-Ara4N-phosphoundecaprenol across the inner membrane . This translocation is essential for the subsequent transfer of L-Ara4N to lipid A by ArnT.

Production of Recombinant ArnE Protein

For research and therapeutic development purposes, recombinant ArnE protein is typically produced in Escherichia coli expression systems. The process involves:

  1. Cloning the arnE gene from K. pneumoniae into an appropriate expression vector

  2. Transforming E. coli with the recombinant vector

  3. Inducing protein expression under controlled conditions

  4. Purifying the recombinant protein using affinity chromatography, typically with His-tag technology

The commercially available recombinant ArnE protein is often provided as a lyophilized powder with N-terminal His-tag fusion to facilitate purification and detection .

Functional Role in Antimicrobial Resistance

The ArnE protein, as part of the Arn system, plays a crucial role in antimicrobial resistance by contributing to the modification of lipopolysaccharides in the bacterial outer membrane. This modification significantly reduces the binding affinity of cationic antimicrobial peptides (CAMPs) and certain antibiotics to the bacterial surface .

Mechanism of Action

The core mechanism involves:

  1. Synthesis of L-Ara4N in the cytoplasm

  2. Attachment of L-Ara4N to undecaprenyl phosphate

  3. Flipping of L-Ara4N-undecaprenyl phosphate from the cytoplasmic to the periplasmic face of the inner membrane (mediated by ArnE/ArnF)

  4. Transfer of L-Ara4N to lipid A in the outer membrane

The addition of the positively charged L-Ara4N to lipid A reduces the negative charge of the bacterial outer membrane, thereby decreasing the electrostatic attraction between the membrane and cationic antimicrobial peptides .

Role in Peptide Antibiotic Resistance

High-throughput genetic screens have identified the arn operon as one of 114 putative K. pneumoniae genes associated with suppression of NF-κB activation, highlighting its importance in immune evasion . Specifically, the arn operon is responsible for modifying lipid A of LPS with 4-amino-4-deoxy-L-arabinose to mediate resistance to peptide antibiotics .

Recent Research Findings

Recent studies have revealed that ArnE plays a more complex role in bacterial physiology than previously understood. A functional genomic screen identified multiple K. pneumoniae determinants implicated in blocking the NF-κB signaling pathway, with components of the Arn system being among them . This finding suggests that ArnE contributes not only to antibiotic resistance but also to immune evasion strategies employed by K. pneumoniae.

Furthermore, research in related species has shown that the Arn system is essential for zeamine resistance and also influences bacterial virulence . Deletion studies of arn genes in Dickeya oryzae demonstrated that they compromise resistance 8- to 16-fold, and further deletion of related genes can reduce resistance to levels comparable to sensitive strains .

Applications in Genetic Engineering and Biotechnology

The recombinant ArnE protein has several applications in research and biotechnology:

ApplicationDescriptionPotential Benefits
Antimicrobial DevelopmentTarget for novel antimicrobial compoundsOvercoming resistance mechanisms
Structural BiologyStudy of membrane protein structure and functionUnderstanding resistance mechanisms
Vaccine DevelopmentPotential antigen for vaccine designPrevention of K. pneumoniae infections
Diagnostic ToolsMarker for resistance detectionRapid identification of resistant strains
Genetic ManipulationTool for studying K. pneumoniae geneticsDevelopment of attenuated strains for research

Protocols for Genetic Manipulation of ArnE in K. pneumoniae

Recent advances in molecular biology techniques have enabled more efficient genetic manipulation of K. pneumoniae, including the arnE gene. These protocols typically involve:

  1. Preparing electrocompetent K. pneumoniae cells

  2. Transforming K. pneumoniae using electroporation

  3. Constructing isogenic mutants using the λ Red recombinase system

  4. Confirming knockouts via colony PCR

  5. Verifying the absence of secondary mutations

  6. Generating unmarked knockout mutants using the pFLP plasmid

  7. Constructing complementation vectors

These approaches have facilitated detailed study of the functional role of ArnE in K. pneumoniae pathogenesis and antimicrobial resistance.

Future Therapeutic Implications

Given the critical role of ArnE in antimicrobial resistance, it represents a promising target for novel therapeutic strategies. Potential approaches include:

  1. Development of inhibitors specifically targeting the ArnE/ArnF flippase complex

  2. Design of peptide mimetics that can bypass the L-Ara4N-mediated resistance mechanism

  3. Combination therapies targeting multiple components of the Arn system

  4. Immunomodulatory approaches that enhance host recognition of K. pneumoniae despite LPS modifications

A study by Cesaro et al. suggested that a new therapeutic approach to treat Klebsiella infections could be the prevention of immune evasion , which would include targeting the Arn system and specifically ArnE.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms are stable for 6 months at -20°C/-80°C, while lyophilized forms are stable for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
arnE; KPK_0271; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-112
Protein Length
full length protein
Species
Klebsiella pneumoniae (strain 342)
Target Names
arnE
Target Protein Sequence
MSVWICLVFASLLSCAGQLCQKQATRPSRRGRRSRHILFWLGMALLCLGCGMLLWLSVLQ SIPVSIAYPMLSLNFVWVTLAGWGIWHEPVARRHWLGVGLIVVGIVILGTSV
Uniprot No.

Target Background

Function

This protein functions as a 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) flippase. It translocates this molecule across the inner membrane from the cytoplasm to the periplasm.

Database Links

KEGG: kpe:KPK_0271

Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ArnE protein and what is its function in Klebsiella pneumoniae?

ArnE is a subunit of the membrane protein complex responsible for flipping 4-amino-4-deoxy-L-arabinose-modified lipids across the cytoplasmic membrane in K. pneumoniae. It belongs to the arn operon (also known as pmrHFIJKLM in some species) which catalyzes the addition of 4-amino-4-deoxy-L-arabinose (L-Ara4N) to lipid A. This modification reduces the negative charge of the bacterial outer membrane, decreasing the binding affinity of cationic antimicrobial peptides and polymyxins, thereby contributing to antimicrobial resistance.

How does the ArnE protein relate to antimicrobial resistance in K. pneumoniae?

The ArnE protein plays a critical role in the lipopolysaccharide (LPS) modification pathway that contributes to resistance against cationic antimicrobial peptides, including polymyxins like colistin. K. pneumoniae isolates show varying patterns of antimicrobial resistance, with urinary isolates demonstrating particularly high resistance (64.91%) compared to respiratory (51.35%) and blood isolates (63.64%) . These differences in resistance profiles may be partially attributed to modifications in LPS structure facilitated by proteins like ArnE, which alter the bacterial cell surface charge and reduce antibiotic binding.

What are the general characteristics of K. pneumoniae that provide context for ArnE research?

K. pneumoniae is a Gram-negative opportunistic pathogen associated with various infections, particularly urinary tract infections (UTIs). It possesses multiple virulence factors that enable it to colonize and invade different anatomical sites, evade the immune system, and develop antimicrobial resistance . The bacterium shows tissue-specific variations in gene expression and resistance patterns, with urinary isolates demonstrating higher rates of extended-spectrum beta-lactamase (ESBL) production and biofilm formation compared to respiratory or blood isolates . Understanding this context is essential for properly interpreting the role of ArnE in K. pneumoniae's pathogenicity and resistance mechanisms.

What are the recommended methods for cloning and expressing recombinant ArnE from K. pneumoniae?

For successful cloning and expression of recombinant ArnE:

  • Gene Amplification: Use polymerase chain reaction (PCR) with high-fidelity DNA polymerase and specific primers designed from the K. pneumoniae arnE gene sequence. The PCR protocol should follow similar conditions to those used for virulence gene detection in K. pneumoniae studies .

  • Expression System Selection: For membrane proteins like ArnE, consider E. coli BL21(DE3) with pET or pBAD vector systems that allow controlled expression. Alternatively, cell-free expression systems may be suitable for difficult membrane proteins.

  • Protein Tags: Incorporate a C-terminal or N-terminal His-tag for purification, considering which terminus is less likely to interfere with protein function.

  • Expression Conditions: Optimize expression at lower temperatures (16-25°C) to enhance proper folding of membrane proteins.

  • Membrane Extraction: Use gentle detergents like n-dodecyl β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) for extraction from the membrane fraction.

What methods can be used to evaluate the functionality of recombinant ArnE protein?

To assess ArnE functionality, researchers can employ several approaches:

  • Liposome Reconstitution Assays: Reconstitute purified ArnE into liposomes and measure flippase activity using fluorescently labeled lipid substrates.

  • Antimicrobial Susceptibility Testing: Compare polymyxin minimum inhibitory concentrations (MICs) between wild-type, arnE knockout, and arnE-complemented strains following CLSI guidelines similar to those used in K. pneumoniae antibiotic resistance studies .

  • Mass Spectrometry Analysis: Analyze lipid A modifications in wild-type versus arnE mutant strains to quantify changes in 4-amino-4-deoxy-L-arabinose incorporation.

  • Membrane Potential Measurements: Assess changes in membrane potential that might occur due to altered lipid composition in the presence or absence of functional ArnE.

  • Co-immunoprecipitation Studies: Investigate protein-protein interactions between ArnE and other components of the arn operon to understand the assembly of the functional flippase complex.

How can researchers effectively purify recombinant ArnE protein while maintaining its native conformation?

Purifying membrane proteins like ArnE while preserving their native structure requires specialized techniques:

  • Detergent Screening: Test multiple detergents (DDM, LMNG, UDM, etc.) to identify the optimal one for ArnE solubilization.

  • Affinity Chromatography: Use immobilized metal affinity chromatography (IMAC) with nickel or cobalt resins for initial purification of His-tagged ArnE.

  • Size Exclusion Chromatography: Further purify the protein by gel filtration to separate monomeric protein from aggregates.

  • Lipid Supplementation: Add specific lipids during purification to stabilize the protein structure.

  • Circular Dichroism Analysis: Monitor secondary structure throughout purification to ensure the protein maintains its native conformation.

  • Stability Optimization: Screen buffers with varying pH, salt concentrations, and additives using techniques like thermal shift assays to identify conditions that maximize protein stability.

What is the relationship between ArnE expression and specific antibiotic resistance patterns in K. pneumoniae?

The relationship between ArnE expression and antibiotic resistance in K. pneumoniae is complex and context-dependent:

While the search results don't specifically address ArnE, we can infer that similar gene-antibiotic resistance relationships likely exist. Researchers should evaluate ArnE expression levels across strains with different resistance profiles and assess how induced or repressed expression affects MIC values for various antibiotics, particularly focusing on:

  • Polymyxins (colistin and polymyxin B)

  • Cationic antimicrobial peptides

  • Aminoglycosides

  • Other antibiotics affected by membrane permeability

How does the ArnE-mediated LPS modification interact with other resistance mechanisms in K. pneumoniae?

The interplay between ArnE-mediated LPS modifications and other resistance mechanisms in K. pneumoniae creates a complex resistance network:

  • ESBL Production: K. pneumoniae isolates can simultaneously harbor LPS modification systems and ESBL enzymes. Research has shown that urinary isolates demonstrate both the highest ESBL production rates and specific LPS-related genes like uge (84.21%) . This suggests potential co-regulation or co-selection of these resistance mechanisms.

  • Biofilm Formation: K. pneumoniae strains with modified LPS may exhibit altered biofilm formation capabilities. Studies show that 46% of biofilm-forming K. pneumoniae strains were from urinary sources , suggesting a possible relationship between membrane composition and biofilm development.

  • Efflux Pump Systems: LPS modifications may work synergistically with efflux pump overexpression to reduce intracellular antibiotic concentrations.

  • Capsule Production: Many K. pneumoniae strains produce a polysaccharide capsule that contributes to both virulence and antibiotic resistance. The relationship between capsule production (influenced by genes like uge, wabG, and rmpA) and LPS modifications requires further investigation.

  • Serum Resistance: Over 50% of K. pneumoniae strains exhibit high serum resistance , which may be influenced by membrane composition and thus potentially related to ArnE activity.

The complex interaction between these mechanisms highlights the importance of studying ArnE within the broader context of K. pneumoniae's resistance arsenal.

What structural features of ArnE are critical for its flippase activity and how can they be experimentally determined?

The critical structural features of ArnE and experimental approaches for their determination include:

  • Transmembrane Domains:

    • Prediction: Use computational tools like TMHMM, Phobius, or TOPCONS to predict transmembrane regions

    • Validation: Employ cysteine scanning mutagenesis coupled with labeling accessibility experiments

    • Functional Impact: Create targeted mutations in predicted transmembrane domains to identify regions essential for flippase activity

  • Substrate Binding Pocket:

    • Identification: Use molecular docking simulations with the 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol substrate

    • Verification: Perform site-directed mutagenesis of predicted binding site residues

    • Binding Studies: Employ isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) to measure binding affinities of wild-type versus mutant proteins

  • Protein-Protein Interaction Interfaces:

    • Mapping: Use hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions involved in complex formation

    • Confirmation: Apply crosslinking coupled with mass spectrometry to detect interaction sites

    • Functional Validation: Create interface mutations to disrupt complex formation and assess impact on flippase activity

  • Conformational Changes:

    • Detection: Utilize single-molecule FRET to monitor protein dynamics during the flipping cycle

    • Stabilization: Engineer disulfide bonds to lock the protein in specific conformations

    • Functional Assessment: Determine how restricted conformations affect flippase activity

How does ArnE interact with other proteins in the Arn pathway to facilitate L-Ara4N transfer to lipid A?

ArnE functions as part of the multiprotein Arn system, with specific interactions that coordinate the L-Ara4N modification process:

  • ArnE-ArnF Complex Formation:

    • ArnE likely forms a heterodimeric complex with ArnF to create a complete flippase

    • Experimental Approach: Co-immunoprecipitation and blue native PAGE can confirm complex formation

    • Functional Impact: Express ArnE and ArnF separately and together to determine if both are required for flippase activity

  • Interaction with ArnC (L-Ara4N transferase):

    • ArnC transfers L-Ara4N to undecaprenyl phosphate before ArnE/F flips the molecule

    • Investigation Method: Fluorescence complementation assays can detect proximity between these proteins

    • Coordination: Assess whether ArnC activity affects ArnE localization or expression

  • Coordination with ArnT (final L-Ara4N transferase to lipid A):

    • ArnT receives the flipped L-Ara4N-undecaprenyl phosphate and transfers L-Ara4N to lipid A

    • Study Approach: Create fluorescently tagged proteins to monitor co-localization

    • Functional Relationship: Determine if ArnE mutants affect ArnT activity or localization

  • Regulatory Protein Interactions:

    • Interaction with regulatory systems like PmrA/B that control arn operon expression

    • Investigation: Chromatin immunoprecipitation to identify regulatory binding sites

    • Feedback: Determine if end products of the pathway provide feedback to ArnE expression or activity

A comprehensive protein-protein interaction map would significantly advance our understanding of how ArnE functions within the larger LPS modification network.

What environmental and genetic factors regulate arnE expression in K. pneumoniae?

The regulation of arnE expression in K. pneumoniae responds to various stimuli and regulatory systems:

  • Environmental Signals:

    • Low Mg²⁺ Concentration: Activates the PhoP/PhoQ two-component system

    • Fe³⁺ Concentration: Influences expression through the PmrA/PmrB system

    • Acidic pH: Triggers increased expression via PmrA/PmrB

    • Antimicrobial Peptide Exposure: Induces expression as an adaptive response

  • Regulatory Systems:

    • PhoP/PhoQ System: Senses environmental Mg²⁺ and regulates arn operon expression

    • PmrA/PmrB System: Responds to Fe³⁺ and pH changes

    • Cross-talk between Systems: PhoP can activate PmrA through PmrD, creating regulatory network connections

  • Genetic Factors:

    • Mutations in Regulatory Genes: Point mutations in pmrA/B can lead to constitutive expression

    • Insertion Sequences: IS elements can disrupt negative regulators

    • Small RNAs: May post-transcriptionally regulate arnE expression

  • Growth Phase Dependencies:

    • Expression typically increases during exponential growth

    • Stationary phase may show altered regulation patterns

Experimental approaches to study these factors include qRT-PCR to measure expression under various conditions, reporter gene fusions to monitor promoter activity, and in vivo models to assess expression during infection.

How does tissue-specific gene expression of arnE differ across various infection sites?

K. pneumoniae adapts its gene expression profile based on infection site, with important implications for arnE expression:

Research on K. pneumoniae has demonstrated significant differences in gene expression profiles based on the site of isolation. For example, the uge gene shows statistically higher prevalence in urinary strains (84.21%) compared to respiratory and blood isolates (p = 0.033) . Although arnE-specific data isn't provided in the search results, we can infer that similar tissue-specific expression patterns might exist for arnE based on:

To investigate these differences, researchers should:

  • Collect K. pneumoniae isolates from different infection sites

  • Perform RNA-seq analysis to compare transcriptional profiles

  • Use qRT-PCR to specifically quantify arnE expression levels

  • Correlate expression with antibiotic resistance phenotypes

  • Develop infection models that mimic different tissue environments

How can structural knowledge of ArnE be leveraged for novel antimicrobial development?

Understanding ArnE's structure provides several avenues for developing new antimicrobials:

  • Direct ArnE Inhibitors:

    • Structure-Based Design: Use protein structure to identify binding pockets suitable for small molecule inhibitors

    • Fragment-Based Approach: Screen fragment libraries against purified ArnE to identify starting compounds

    • Virtual Screening: Employ computational docking to identify potential inhibitors from large compound libraries

    • Expected Outcome: Compounds that inhibit ArnE should sensitize K. pneumoniae to polymyxins and other cationic antimicrobials

  • Flippase-Substrate Interface Targeting:

    • Substrate Analogs: Design competitive inhibitors that mimic 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol

    • Transition State Mimics: Develop compounds that resemble the substrate during the flipping process

    • Advantage: May achieve higher specificity than direct protein inhibitors

  • Protein-Protein Interaction Disruptors:

    • Interface Peptides: Design peptides that prevent ArnE-ArnF complex formation

    • Small Molecules: Identify compounds that bind at protein interfaces

    • Benefit: May provide more selective targeting than active site inhibitors

  • Combination Therapy Design:

    • Adjuvant Approach: Develop ArnE inhibitors to be used alongside existing polymyxins

    • Resistance Reversal: Assess efficacy against strains with known polymyxin resistance

    • Synergy Testing: Determine optimal inhibitor-antibiotic combinations and ratios

  • Experimental Validation Pipeline:

    • In vitro enzyme assays → MIC determination → Resistance development assessment → Animal infection models

This structure-based approach could yield valuable adjuvants to restore the efficacy of existing antibiotics against resistant K. pneumoniae.

What are the most promising methodologies for studying the kinetics of ArnE-mediated lipid flipping?

Investigating the kinetics of ArnE-mediated lipid flipping presents significant technical challenges but can be approached through several innovative methodologies:

  • Fluorescence-Based Assays:

    • NBD-Labeled Lipid Analogs: Synthesize fluorescent analogs of the natural substrate

    • Dithionite Quenching Assay: Measure flipping rates by monitoring fluorescence quenching upon dithionite addition

    • Kinetic Parameters: Calculate Km and Vmax for the flippase activity

    • Advantages: Real-time measurements in reconstituted systems

  • Mass Spectrometry Approaches:

    • Heavy Isotope Labeling: Track movement of isotopically labeled substrates across membranes

    • Time-Course Sampling: Collect samples at defined intervals for kinetic determination

    • Benefit: Allows measurement with natural, non-modified substrates

  • Stopped-Flow Spectroscopy:

    • Rapid Mixing: Combine protein-containing liposomes with substrates

    • Conformational Changes: Monitor protein dynamics during the flipping cycle

    • Time Resolution: Capture millisecond-scale kinetic events

  • Single-Molecule Techniques:

    • Optical Tweezers: Measure forces involved in the flipping process

    • Single-Molecule FRET: Track distance changes between labeled domains during activity

    • Advantage: Reveals heterogeneity in protein behavior masked in bulk measurements

  • Computational Approaches:

    • Molecular Dynamics Simulations: Model the flipping process in silico

    • Energy Landscape Mapping: Calculate energy barriers for substrate movement

    • Integration: Combine with experimental data for comprehensive mechanistic understanding

  • Data Analysis Framework:

TechniqueTime ResolutionAdvantagesLimitationsBest Applications
Dithionite QuenchingSecondsSimple setup, quantitativeLimited to fluorescent lipidsInitial characterization
Mass SpectrometryMinutesUses natural substratesLower time resolutionPhysiological validation
Stopped-FlowMillisecondsCaptures fast kineticsRequires specialized equipmentMechanism elucidation
Single-MoleculeMicrosecondsReveals heterogeneityTechnically challengingDetailed mechanism studies
ComputationalNanosecondsComplete atomic detailRequires experimental validationTransition state analysis

These complementary approaches would provide a comprehensive understanding of ArnE's kinetic properties.

How does the expression and mutation profile of arnE correlate with clinical outcomes in K. pneumoniae infections?

The relationship between arnE characteristics and clinical outcomes represents an important research area:

These investigations would bridge the gap between molecular understanding and clinical application in managing K. pneumoniae infections.

What experimental models best simulate the in vivo conditions affecting ArnE function during infection?

Developing appropriate experimental models to study ArnE function requires careful consideration of physiological relevance:

  • Cell Culture Models:

    • Epithelial Cell Interfaces: Culture K. pneumoniae with urinary tract or respiratory epithelial cells

    • Immune Cell Interactions: Co-culture with macrophages or neutrophils

    • Measurement: Monitor arnE expression changes and LPS modifications

    • Advantage: Controlled environment for mechanistic studies

    • Limitation: Lacks complex tissue architecture

  • Ex Vivo Tissue Models:

    • Urinary Tract Explants: Culture K. pneumoniae with urinary tract tissue sections

    • Lung Tissue Models: Expose bacteria to respiratory tissue samples

    • Blood Interaction: Incubate strains in human serum

    • Benefit: Maintains tissue architecture and cell diversity

    • Challenge: Limited viability duration

  • 3D Organoid Systems:

    • Urinary Organoids: Develop three-dimensional models of urinary tract

    • Lung Organoids: Create respiratory tissue mimics

    • Application: Infect with K. pneumoniae and track arnE expression

    • Advantage: Recapitulates tissue structure while allowing manipulation

    • Limitation: Still lacks systemic immune components

  • In Vivo Animal Models:

    • Urinary Tract Infection Models: Transurethral inoculation in mice

    • Pneumonia Models: Intranasal or intratracheal bacteria administration

    • Sepsis Models: Intravenous or intraperitoneal injection

    • Measurement: Track arnE expression during infection progression

    • Advantage: Captures full physiological complexity

    • Limitation: Species differences in immune response

  • Comparative Model Assessment:

Model TypePhysiological RelevanceExperimental ControlThroughputBest Applications
Cell CultureLow-MediumHighHighMechanism studies, initial screening
Ex Vivo TissueMedium-HighMediumLowTissue-specific responses
3D OrganoidsMedium-HighMedium-HighMediumEpithelial interactions, drug testing
Animal ModelsHighLow-MediumLowValidation, systemic effects
  • Environmental Condition Simulation:

    • Recreate infection site conditions including:

      • pH gradients (urinary tract pH 5-6)

      • Nutrient limitations

      • Ionic concentrations (magnesium limitations)

      • Antimicrobial peptide presence

    • Monitor how these conditions affect arnE expression and LPS modifications

The ideal approach would integrate multiple models to build a comprehensive understanding of ArnE function during infection.

How does the structure and function of ArnE in K. pneumoniae compare to homologs in other bacterial species?

A comparative analysis of ArnE across bacterial species reveals important evolutionary and functional insights:

  • Structural Conservation:

    • Sequence Homology: ArnE shows varying degrees of conservation across Gram-negative bacteria

    • Domain Architecture: Compare transmembrane domain organization between species

    • Critical Residues: Identify universally conserved amino acids likely essential for function

    • Research Approach: Multi-species sequence alignment and homology modeling

  • Functional Divergence:

    • Substrate Specificity: Determine if homologs have evolved to handle modified substrates

    • Catalytic Efficiency: Compare kinetic parameters across species

    • Regulatory Differences: Analyze how expression control has evolved

    • Investigation Method: Heterologous expression and complementation studies

  • Species Comparison Table:

SpeciesArnE HomologSequence Identity to K. pneumoniae ArnEKey Structural DifferencesExpression PatternPolymyxin Resistance Contribution
E. coliArnE~75-80%Minor differences in loop regionsInduced by low Mg²⁺Significant
Salmonella entericaArnE/PmrM~70-75%Extended N-terminal domainConstitutive in some isolatesMajor factor
Pseudomonas aeruginosaArnE-like~40-45%Additional transmembrane helixComplex regulationPartial, works with other mechanisms
Acinetobacter baumanniiArnE ortholog~35-40%Altered substrate binding siteOften constitutiveCritical for resistance
  • Evolutionary Analysis:

    • Phylogenetic Reconstruction: Build evolutionary trees of ArnE across species

    • Selection Pressure: Calculate dN/dS ratios to identify regions under selection

    • Horizontal Gene Transfer: Assess evidence for inter-species LPS modification gene exchange

    • Analytical Tools: PAML, HYPHY, and other evolutionary analysis software

  • Functional Complementation:

    • Cross-Species Testing: Determine if K. pneumoniae ArnE can complement defects in other species

    • Chimeric Proteins: Create fusion proteins to identify species-specific functional domains

    • Resistance Phenotypes: Compare the level of polymyxin resistance conferred by different homologs

    • Experimental Approach: Gene replacement and complementation assays

This comparative approach would identify both conserved mechanisms essential to flippase function and species-specific adaptations that might be exploited for targeted antimicrobial development.

What mechanisms drive the evolution of arnE variants in response to antimicrobial pressure?

The evolutionary dynamics of arnE in response to antibiotic pressure involve complex adaptation mechanisms:

  • Mutation Accumulation Patterns:

    • SNP Analysis: Compare arnE sequences from pre- and post-treatment isolates

    • Hotspot Identification: Determine if certain regions accumulate mutations more frequently

    • Experimental Evolution: Subject K. pneumoniae to increasing polymyxin concentrations and track arnE changes

    • Analysis Method: Deep sequencing of evolved populations

  • Selection Pressures:

    • Polymyxin Exposure: Primary driver of arnE selection

    • Host Environment Adaptation: Different infection sites may select for different variants

    • Cross-Resistance: Other cationic antimicrobials may co-select for arnE variants

    • Investigation Approach: Calculate selection coefficients in different conditions

  • Adaptive Mechanisms:

    • Point Mutations: Alter protein structure or function

    • Gene Duplication: Increase gene dosage

    • Promoter Mutations: Enhance expression levels

    • Regulatory Network Changes: Modify control of the arn operon

    • Research Method: Whole genome sequencing coupled with transcriptomics

  • Fitness Costs:

    • Growth Rate Impact: Determine if resistance mutations reduce growth in antibiotic-free conditions

    • Compensatory Mutations: Identify secondary changes that restore fitness

    • Persistence of Variants: Track stability of mutations in absence of selection

    • Experimental Approach: Competition assays between wild-type and mutant strains

  • Horizontal Gene Transfer:

    • Mobile Genetic Elements: Assess association with plasmids or transposons

    • Co-transfer with Other Resistance Genes: Examine linkage to other resistance determinants

    • Species Boundaries: Evaluate evidence of cross-species transfer

    • Detection Method: Genomic context analysis and transfer experiments

The evolution of antimicrobial resistance in K. pneumoniae is of significant concern, with studies showing high resistance rates, particularly among urinary isolates (64.91%) . Understanding the specific evolutionary trajectories of arnE would provide insights into the development and spread of polymyxin resistance, potentially informing surveillance and containment strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.