Recombinant Klebsiella pneumoniae Probable intracellular septation protein A (KPK_3196)

Shipped with Ice Packs
In Stock

Description

Host-Pathogen Interactions

K. pneumoniae proteins like KPK_3196 interact with host immune regulators such as HIF1A, STAT1, and TP53, which coordinate immune signaling, proteasomal degradation, and DNA damage response . For example:

  • TP53 (tumor suppressor P53) modulates immune responses and hypoxia pathways, which are critical during lung infections .

  • STAT1 and HIF1A cross-talk with TP53, suggesting KPK_3196 may indirectly influence host immune evasion .

Pathways of Interest

PathwayAssociated ProteinsFunctional Role
Immune SignalingTP53, STAT1, HIF1AMediates cytokine production and inflammation
Proteasomal DegradationUbiquitin ligasesRegulates immune checkpoint proteins
DNA Damage ResponseCDC5L, TP53Affects bacterial survival under stress

Research Applications

KPK_3196 is utilized in diverse experimental contexts:

Key Applications

  • Drug Target Identification: Used in yeast two-hybrid and co-IP assays to map protein interactions .

  • ELISA Development: Commercial ELISA kits employ recombinant KPK_3196 for pathogen detection .

  • Bacterial Pathogenesis Studies: Investigates septation mechanisms in K. pneumoniae .

Inhibitory Compound Screening

Flavonoids like Rutin (256–512 µg/mL) inhibit K. pneumoniae growth, though KPK_3196-specific inhibition data remain unexplored . This highlights potential for future studies targeting septation proteins.

Multi-Omics Insights

Transcriptomic and metabolomic analyses of K. pneumoniae under stress (e.g., antibiotic exposure) reveal:

  • DEGs (Differentially Expressed Genes): Enriched in purine metabolism (ko00230) and membrane transport (ko01120) pathways .

  • DAMs (Differentially Accumulated Metabolites): Quercetin (C00389) and L-threonine (C00188) correlate with bacterial adaptation .

Future Directions

  • Mechanistic Studies: Clarify KPK_3196’s role in septation via CRISPR knockouts or cryo-EM.

  • Therapeutic Development: Explore KPK_3196 as a vaccine antigen or antibiotic target .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development if feasible.
Synonyms
yciB; KPK_3196; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Klebsiella pneumoniae (strain 342)
Target Names
KPK_3196
Target Protein Sequence
MKQFLDFLPLVVFFAFYKLYDIYAATTALIVATAIVLIYSWVRYRKVEKMALITFVLVAV FGGLTLFFHNDEFIKWKVTVIYALFAGALLFSQWVMKKPLIQRMLGKELALPQQVWSRLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLVFTLLSGIYIYRHMPQDDHH
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links

KEGG: kpe:KPK_3196

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Klebsiella pneumoniae KPK_3196 protein and what is its function?

KPK_3196 protein is a probable intracellular septation protein A found in Klebsiella pneumoniae (strain 342). As an intracellular septation protein, it likely plays a role in cell division processes. Klebsiella pneumoniae is a Gram-negative, non-motile, encapsulated, lactose-fermenting, facultative anaerobic, rod-shaped bacterium that can cause various infections in humans, including pneumonia, urinary tract infections, wound infections, meningitis, and septicemia .

The specific function of KPK_3196 has not been fully characterized, but based on homology with similar proteins in other bacteria, it is believed to be involved in septum formation during bacterial cell division. Research approaches to characterize its function typically include gene knockout studies, protein localization experiments using fluorescent tags, and protein-protein interaction analyses to identify binding partners within the cell division machinery.

What expression systems are commonly used for producing recombinant KPK_3196 protein?

Recombinant KPK_3196 protein can be produced using various expression systems including:

  • Escherichia coli

  • Yeast

  • Baculovirus

  • Mammalian cell expression systems

E. coli is often the first choice due to its rapid growth, high protein yields, and established protocols. For functional studies requiring post-translational modifications, eukaryotic systems like yeast or mammalian cells may be preferable. When selecting an expression system, researchers should consider:

  • Required protein folding and post-translational modifications

  • Protein solubility and potential for inclusion body formation

  • Expression level requirements

  • Downstream purification strategy compatibility

  • Endotoxin considerations for subsequent applications

Optimization often involves testing multiple expression constructs with varying tags (His, GST, MBP) to enhance solubility and facilitate purification.

What safety precautions should researchers follow when working with recombinant K. pneumoniae proteins?

Working with recombinant K. pneumoniae proteins requires strict adherence to biosafety guidelines:

  • Follow the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules, which were most recently updated in April 2024 .

  • Work in appropriate biosafety level facilities (typically BSL-2 for recombinant proteins).

  • Use personal protective equipment including lab coats, gloves, and eye protection.

  • Implement proper disposal procedures for all materials containing or exposed to the recombinant proteins.

  • Maintain detailed documentation of all experiments and safety procedures.

It's important to note that recombinant proteins produced for research cannot be used directly in humans or animals . Institutional Biosafety Committee (IBC) approval is typically required before conducting experiments with recombinant K. pneumoniae components, and researchers must complete appropriate biosafety training.

How can researchers verify the purity and activity of recombinant KPK_3196 protein?

Verification of recombinant KPK_3196 protein purity and activity involves multiple analytical techniques:

Purity Assessment:

  • SDS-PAGE with Coomassie or silver staining (expect >90% purity for most applications)

  • Western blotting using anti-His tag or specific KPK_3196 antibodies

  • Size exclusion chromatography to assess aggregation state

  • Mass spectrometry for accurate molecular weight determination and identification of potential contaminants

Activity Verification:

  • Functional binding assays to known interaction partners

  • Enzymatic activity assays if the protein has known catalytic functions

  • Structural integrity assessment through circular dichroism spectroscopy

  • Thermal shift assays to evaluate protein stability

Protein activity should be evaluated in comparison to established positive controls, and multiple batches should be tested to ensure reproducibility of results.

How does KPK_3196 potentially contribute to K. pneumoniae pathogenesis and host-pathogen interactions?

Although the specific role of KPK_3196 in K. pneumoniae pathogenesis isn't directly established in the available research, it may contribute to bacterial fitness during infection. K. pneumoniae is known to interact with host immune cells in sophisticated ways, particularly with lung macrophages during pneumonia.

Recent single-cell transcriptomics research has revealed that K. pneumoniae primarily associates with interstitial macrophages (IMs) in the lungs during infection. At 24 hours post-infection, approximately 31% of IMs were associated with K. pneumoniae, compared to only 5% of alveolar macrophages (AMs) . This suggests cell-type specific interactions that may be influenced by bacterial proteins involved in septation and cell division.

K. pneumoniae has been shown to hijack a previously unknown TLR-type I IFN-IL10-STAT6 innate axis to rewire macrophages toward a unique polarization state termed M(Kp) . This macrophage reprogramming facilitates intracellular survival of the pathogen. Future research exploring whether KPK_3196 plays a role in these processes would be valuable.

What experimental approaches can be used to investigate the role of KPK_3196 in K. pneumoniae capsule formation and virulence?

Investigating KPK_3196's potential role in capsule formation and virulence requires multifaceted experimental approaches:

Genetic Manipulation Strategies:

  • Generate KPK_3196 deletion mutants using CRISPR-Cas9 or allelic exchange

  • Create complemented strains expressing wild-type or modified KPK_3196

  • Develop fluorescently tagged KPK_3196 to track localization during infection

Phenotypic Characterization:

  • Assess capsule production through India ink staining and uronic acid quantification

  • Compare growth kinetics in various media conditions

  • Evaluate biofilm formation capabilities

  • Measure resistance to antimicrobials and host defense peptides

Virulence Assessment:

  • In vitro infection models using macrophage cell lines

  • Analysis of intracellular survival within macrophages

  • Evaluation of macrophage polarization states (M1/M2/M(Kp))

  • In vivo mouse models of pneumonia with bacterial burden quantification

Research has shown that K. pneumoniae's capsule polysaccharide is a key factor governing the M(Kp) polarization of macrophages . Determining whether KPK_3196 influences capsule synthesis or regulation would provide insights into bacterial pathogenesis mechanisms.

How can single-cell transcriptomics approaches be optimized for studying KPK_3196 function during infection?

Optimizing single-cell transcriptomics to study KPK_3196 function during infection requires careful experimental design:

Experimental Design Considerations:

  • Generate reporter strains expressing fluorescently tagged KPK_3196 to track protein localization

  • Create KPK_3196 deletion mutants for comparative studies

  • Establish in vivo infection models with wild-type and mutant strains

Technical Optimization:

  • Cell isolation protocols must be refined to efficiently recover both bacteria and host cells from infected tissues

  • Flow cytometry sorting parameters should be optimized to separate infected from uninfected cells

  • Low-input RNA sequencing protocols must be employed for bacterial transcripts

Data Analysis Approach:

  • Implement trajectory analysis to track transcriptional changes over time

  • Use pathway analysis to identify networks affected by KPK_3196 presence/absence

  • Apply pseudotime analysis to reconstruct the sequence of transcriptional events

Based on previous research using single-cell RNA-seq to study K. pneumoniae infections, data should be analyzed for differential expression of genes related to:

  • Type I IFN stimulated genes (isg15, cxc10, ifit1, usp18, irgm1, irg1)

  • IL10 signaling (ptgs2, csf1, ptafr)

  • IL4 signaling and macrophage polarization (nos2, arg1, lcn2, socs1, socs3)

This approach has successfully identified that interstitial macrophages are the main population associated with K. pneumoniae during infection, with 31% of IMs containing bacteria at 24 hours post-infection .

What are the most effective strategies for designing inhibitors targeting KPK_3196 for antimicrobial development?

Designing inhibitors targeting KPK_3196 involves a structured drug discovery pipeline:

Target Validation and Characterization:

  • Confirm essentiality of KPK_3196 for bacterial viability or virulence

  • Determine protein structure using X-ray crystallography, NMR, or cryo-EM

  • Identify active sites or protein-protein interaction domains

  • Assess conservation across Klebsiella strains and related species

Screening Approaches:

  • Structure-based virtual screening using molecular docking

  • Fragment-based screening to identify chemical scaffolds with binding potential

  • High-throughput biochemical assays to test compound libraries

  • Phenotypic screening using KPK_3196 reporter strains

Lead Optimization Strategies:

  • Structure-activity relationship studies to improve potency and selectivity

  • ADME-Tox optimization to enhance drug-like properties

  • Resistance development assessment through serial passage experiments

  • Evaluation in cellular and animal infection models

A promising direction might involve targeting the septation process during K. pneumoniae infection of macrophages, as the ability of K. pneumoniae to polarize macrophages toward the M(Kp) state facilitates its intracellular survival . Inhibitors that prevent this polarization could potentially enhance bacterial clearance.

What protocols are recommended for studying KPK_3196 interactions with host macrophages?

Studying KPK_3196 interactions with host macrophages requires specialized protocols:

Macrophage Culture and Differentiation:

  • Isolate primary macrophages from mouse lungs (both interstitial and alveolar populations)

  • Alternatively, differentiate THP-1 or U937 human monocyte cell lines into macrophages

  • Generate bone marrow-derived macrophages (BMDMs) and polarize toward M1 or M2 states before infection

Infection Protocol:

  • Use fluorescently labeled K. pneumoniae strains (wild-type and KPK_3196 mutants)

  • Optimize MOI (multiplicity of infection) based on experimental goals

  • Synchronize infection through centrifugation

  • Remove extracellular bacteria using gentamicin protection assay

Analysis Methods:

  • Confocal microscopy for protein localization studies

  • Flow cytometry to assess macrophage polarization markers

  • qRT-PCR analysis of key genes including isg15, cxcl10, irg1, nos2, arg1

  • ELISA to measure cytokine production

Based on published research, special attention should be paid to markers of the M(Kp) polarization state, which includes elements of both M1 and M2 polarization and is characterized by upregulation of Arg1, Fizz1, and CD163 . Additionally, researchers should monitor the activation of STAT6, as K. pneumoniae has been shown to exploit this transcription factor for intracellular survival .

How can researchers troubleshoot poor expression or solubility issues with recombinant KPK_3196?

Troubleshooting poor expression or solubility of recombinant KPK_3196 involves systematic optimization:

Expression Optimization Strategies:

  • Test multiple expression vectors with different promoters (T7, tac, etc.)

  • Evaluate different E. coli strains (BL21(DE3), Rosetta, Arctic Express)

  • Optimize induction conditions (IPTG concentration, temperature, duration)

  • Screen growth media formulations (LB, TB, auto-induction)

Solubility Enhancement Approaches:

  • Add solubility-enhancing fusion tags (MBP, SUMO, TrxA)

  • Co-express with molecular chaperones (GroEL/ES, DnaK)

  • Test expression at lower temperatures (16-18°C)

  • Implement batch or fed-batch fermentation strategies

Refolding Strategies:

  • Isolate inclusion bodies and optimize washing procedures

  • Screen refolding buffers varying pH, ionic strength, and additives

  • Employ step-wise dialysis or on-column refolding techniques

  • Validate refolded protein structure with circular dichroism

Decision Tree for Expression Troubleshooting:

IssueFirst ApproachSecond ApproachThird Approach
No expressionCheck codon optimizationTest different vector/promoterVerify DNA sequence
Low expressionOptimize induction parametersChange E. coli strainReduce growth temperature
Insoluble proteinAdd solubility tagsCo-express chaperonesDevelop refolding protocol
Degraded proteinAdd protease inhibitorsExpress in protease-deficient strainsOptimize purification speed

Each optimization step should be assessed through small-scale test expressions followed by SDS-PAGE and Western blot analysis before scaling up.

What are the recommended experimental controls when studying the effects of KPK_3196 on macrophage polarization?

Robust experimental controls are essential when investigating KPK_3196's effects on macrophage polarization:

Genetic Controls:

  • Wild-type K. pneumoniae strain

  • KPK_3196 deletion mutant

  • Complemented KPK_3196 mutant

  • Mutants of known polarization-inducing factors (e.g., capsule-deficient mutants)

Macrophage Polarization Controls:

  • Unstimulated macrophages (M0)

  • Classically activated macrophages (M1): LPS + IFNγ

  • Alternatively activated macrophages (M2a): IL-4 + IL-13

  • Regulatory macrophages (M2b): Immune complexes + TLR ligands

  • Deactivated macrophages (M2c): IL-10, TGF-β, or glucocorticoids

Analytical Controls:

  • Isotype controls for flow cytometry antibodies

  • Fluorescence-minus-one (FMO) controls for multicolor flow panels

  • Housekeeping genes for qRT-PCR normalization

  • Time course analyses to capture polarization dynamics

Based on research findings, investigators should measure markers characteristic of the M(Kp) polarization state, including Arg1, Fizz1, and CD163, as well as signaling pathway components such as STAT6 phosphorylation . Additionally, the unique transcriptional signature identified through single-cell RNA-seq, including ISGs, IL10 signaling genes, and macrophage polarization markers should be assessed .

How can researchers accurately quantify K. pneumoniae intracellular survival in relation to KPK_3196 expression?

Accurate quantification of K. pneumoniae intracellular survival requires specialized techniques:

Gentamicin Protection Assay Protocol:

  • Infect macrophages with wild-type and KPK_3196 mutant K. pneumoniae strains

  • After allowing for bacterial uptake, treat with gentamicin to kill extracellular bacteria

  • Lyse macrophages at various time points post-infection

  • Plate lysates on appropriate media to enumerate colony-forming units (CFUs)

Advanced Quantification Methods:

  • Flow cytometry-based detection of fluorescently labeled bacteria

  • Confocal microscopy with automated image analysis

  • Luciferase-based reporter systems for real-time monitoring

  • qPCR quantification of bacterial DNA

Experimental Manipulations:

  • Treat macrophages with STAT6 inhibitors to block M(Kp) polarization

  • Inhibit glycolysis to interfere with M(Kp) metabolism

  • Compare intracellular survival in different macrophage subtypes (AMs vs. IMs)

  • Evaluate the impact of capsule expression on intracellular survival

Research has demonstrated that absence of STAT6 limits the intracellular survival of K. pneumoniae, and inhibition of STAT6 facilitates pathogen clearance in vivo . Similarly, inhibition of glycolysis, which characterizes M(Kp) metabolism, has been shown to result in clearance of intracellular K. pneumoniae . These findings provide important control conditions for evaluating how KPK_3196 might influence bacterial survival within macrophages.

What are the most promising future research directions for understanding KPK_3196 function?

Future research on KPK_3196 should focus on several promising avenues:

  • Structural Biology Approaches:

    • Determine the high-resolution structure of KPK_3196

    • Characterize protein-protein interaction networks involving KPK_3196

    • Investigate structural changes during bacterial cell division

  • Host-Pathogen Interaction Studies:

    • Explore whether KPK_3196 contributes to the unique M(Kp) macrophage polarization

    • Investigate if KPK_3196 interacts with host cell machinery during intracellular residence

    • Determine whether KPK_3196 is recognized by host pattern recognition receptors

  • Systems Biology Integration:

    • Perform multi-omics analyses combining transcriptomics, proteomics, and metabolomics

    • Develop computational models of K. pneumoniae septation incorporating KPK_3196 function

    • Map KPK_3196 into broader virulence networks

  • Translational Applications:

    • Evaluate KPK_3196 as a potential vaccine component

    • Screen for small molecule inhibitors that target KPK_3196 function

    • Develop diagnostic tools based on KPK_3196 detection

Given the finding that K. pneumoniae capsule polysaccharide governs M(Kp) polarization , investigating potential interactions between capsule synthesis machinery and KPK_3196 would be particularly valuable. Additionally, the demonstrated importance of the type I IFN-IL10-STAT6-dependent pathway in human macrophage polarization by K. pneumoniae suggests that examining KPK_3196's role in this process could yield important insights into pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.