Recombinant Klebsiella pneumoniae Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ubiB; KPK_5342; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-546
Protein Length
full length protein
Species
Klebsiella pneumoniae (strain 342)
Target Names
ubiB
Target Protein Sequence
MTPGELRRLYFIIHTFLSYGLDELIPKIRLTLPLRIWRRMLFWMPNRHQDQPLGTRLRLA LQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDRVAPFEGKLAQQQIEKAMGGLPVDA WFDDFSVEPLASASIAQVHTARLKENGKEVVIKVIRPDILPIIKADMKLIYRLARWVPRL LPDGRRLRPQEVVREYEKTLLDELNLLRESANAIQLRRNFEDSPMLYVPEVYPDYCSESM MVMERIYGIPVSDVEALEAQGTNMQLLAERGVQVFFTQVFRDSFFHADMHPGNIFVSYEH PEDPQYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHVDSGWVPPDTNVEEFE FAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGVGRQLY PQLDLWKTAKPFLESWIKDQVGIPALVRAFKDKAPFWIERMPEIPELVYQSLQQSKQLQT SVDTIVRDMHVRHVRQGQSRYLFGIGAVLLLSGTLLFIHRPEWGMMPGWLMAGGVVTWLI GWRKTH
Uniprot No.

Target Background

Function
This protein is likely a kinase regulator of UbiI activity, which is involved in the aerobic biosynthesis of coenzyme Q (ubiquinone).
Database Links

KEGG: kpe:KPK_5342

Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Klebsiella pneumoniae UbiB protein and what is its primary function?

Klebsiella pneumoniae UbiB protein is a probable ubiquinone biosynthesis protein involved in the electron transport chain responsible for cellular respiration. The protein plays a critical role in the biosynthetic pathway of ubiquinone (also known as coenzyme Q), which functions as an electron carrier in the respiratory chain and serves as an antioxidant in bacterial membranes . UbiB belongs to a family of proteins that participate in the oxygen-dependent hydroxylation reactions during ubiquinone biosynthesis, though recent research suggests homologous proteins may also function in oxygen-independent pathways . The full-length protein (aa 1-546) in strain 342 of K. pneumoniae has been studied through recombinant expression systems to better understand its structure and function . Understanding UbiB's role is particularly important as it relates to bacterial energy metabolism and potentially to virulence and antibiotic resistance.

What techniques are commonly used to express recombinant Klebsiella pneumoniae UbiB protein?

Recombinant Klebsiella pneumoniae UbiB protein is commonly expressed using several heterologous expression systems, with E. coli being the most frequently employed host organism due to its rapid growth and genetic tractability . Alternative expression systems include yeast, baculovirus-infected insect cells, and mammalian cell cultures, each offering distinct advantages depending on the research objectives . The methodology typically involves cloning the ubiB gene from K. pneumoniae into an appropriate expression vector containing an inducible promoter and affinity tag for purification. For successful expression, researchers must optimize conditions including temperature, induction time, and inducer concentration to maximize protein yield while maintaining proper folding and activity. Purification of the recombinant protein generally utilizes affinity chromatography based on the incorporated tag (commonly His-tag or GST-tag), followed by additional purification steps such as ion exchange or size exclusion chromatography to achieve high purity.

What are the optimal experimental conditions for studying UbiB enzymatic activity in vitro?

Optimal experimental conditions for studying UbiB enzymatic activity in vitro require careful consideration of the protein's native environment and catalytic requirements. The assay buffer should typically maintain a pH range of 7.0-8.0 to mimic physiological conditions, with the addition of divalent metal ions such as Mg²⁺ or Mn²⁺ that may serve as cofactors for enzymatic activity . Since UbiB is involved in ubiquinone biosynthesis, the reaction mixture should include appropriate substrates based on the hypothesized step catalyzed by UbiB, potentially including prenyl diphosphates and aromatic precursors of the ubiquinone pathway. Given that ubiquinone biosynthesis involves both oxygen-dependent and oxygen-independent pathways, researchers must carefully control oxygen levels in the experimental setup, potentially using anaerobic chambers for studying UbiB in the context of oxygen-independent pathways . Including appropriate electron donors and acceptors in the reaction system is crucial for observing UbiB activity, as the protein likely functions within a larger electron transport network.

How can researchers effectively differentiate between oxygen-dependent and oxygen-independent functions of UbiB-like proteins?

Researchers can effectively differentiate between oxygen-dependent and oxygen-independent functions of UbiB-like proteins through a combination of genetic, biochemical, and analytical approaches. Comparative growth experiments under aerobic versus anaerobic conditions with wild-type and ubiB mutant strains can reveal whether the protein is essential in either or both oxygen conditions . Metabolic labeling studies using isotope-labeled precursors can track the flow of metabolites through the ubiquinone biosynthetic pathway under varying oxygen tensions, potentially identifying different intermediates that accumulate in the absence of UbiB. In vitro enzyme assays designed to measure specific hydroxylation reactions catalyzed by UbiB should be conducted in parallel under strictly controlled oxygen conditions, utilizing oxygen electrodes to monitor consumption during the reaction . Advanced analytical techniques such as liquid chromatography-mass spectrometry (LC-MS) provide powerful tools for identifying and quantifying ubiquinone intermediates in different experimental conditions, allowing researchers to map the precise biochemical steps affected by UbiB in both oxygen-dependent and independent contexts.

What structural analysis techniques are most informative for characterizing UbiB protein and its interactions?

The most informative structural analysis techniques for characterizing UbiB protein include X-ray crystallography, cryo-electron microscopy (cryo-EM), and nuclear magnetic resonance (NMR) spectroscopy, each offering distinct advantages for different aspects of protein structure determination. X-ray crystallography provides atomic-level resolution of the protein structure but requires successful crystallization of the purified protein, which can be challenging for membrane-associated proteins like UbiB. Cryo-EM has emerged as a powerful alternative that does not require crystallization and is particularly valuable for studying larger protein complexes, potentially revealing how UbiB interacts with other components of the ubiquinone biosynthetic machinery. For studying protein dynamics and smaller domain interactions, NMR spectroscopy offers insights into protein flexibility and ligand binding, though it is generally limited to smaller proteins or protein domains. Complementary techniques that provide valuable structural information include hydrogen-deuterium exchange mass spectrometry (HDX-MS) for mapping protein-protein interaction surfaces, small-angle X-ray scattering (SAXS) for low-resolution structural envelopes, and computational approaches such as molecular dynamics simulations to predict protein behavior in different environments. These structural studies are particularly informative when combined with site-directed mutagenesis to validate the functional significance of specific structural features.

How does UbiB function potentially contribute to Klebsiella pneumoniae virulence?

UbiB function potentially contributes to Klebsiella pneumoniae virulence through its essential role in ubiquinone biosynthesis, which directly impacts bacterial energy metabolism and stress resistance. Ubiquinone is crucial for electron transport during respiration, generating the proton-motive force necessary for ATP synthesis, thereby providing energy for various virulence mechanisms including capsule production, biofilm formation, and efflux pump activity . The ability to synthesize ubiquinone under varying oxygen conditions, potentially involving UbiB-related pathways, may enhance K. pneumoniae's adaptability within the host environment, where oxygen availability fluctuates significantly across different tissues and infection sites . Recent research on hypervirulent strains of K. pneumoniae suggests that metabolic adaptability is a key factor in their enhanced pathogenicity, with energy metabolism pathways potentially playing a critical role in the transition from commensal to pathogenic states . Furthermore, ubiquinone's antioxidant properties may help protect the bacterium against reactive oxygen species produced during the host immune response, potentially contributing to bacterial persistence during infection.

What evidence exists for UbiB's role in antibiotic resistance mechanisms in Klebsiella pneumoniae?

While direct evidence specifically linking UbiB to antibiotic resistance in Klebsiella pneumoniae is limited in the current literature, several indirect connections suggest potential involvement in resistance mechanisms. Ubiquinone biosynthesis pathways, in which UbiB participates, are critical for maintaining the proton-motive force across the bacterial membrane, which drives many energy-dependent antibiotic efflux pumps that export antibiotics from the bacterial cell . Research on hypervirulent K. pneumoniae strains has documented increasing acquisition of drug resistance genes, creating what researchers describe as "true and dreaded superbugs" with both enhanced virulence and multidrug resistance capabilities . The ability to synthesize ubiquinone under varying oxygen conditions may contribute to bacterial persistence in microaerobic or anaerobic infection sites where certain antibiotics are less effective, potentially providing a window for the development of resistance through other mechanisms . Additionally, metabolic adaptations involving electron transport chains have been implicated in tolerance to several antibiotic classes, suggesting that alterations in ubiquinone biosynthesis could potentially modulate susceptibility to antibiotics through changes in membrane potential or cellular energetics.

How can UbiB be targeted in therapeutic development approaches against Klebsiella pneumoniae infections?

Targeting UbiB in therapeutic development against Klebsiella pneumoniae infections requires strategic approaches that exploit the protein's essential role in bacterial metabolism while minimizing effects on host cells. Structure-based drug design targeting unique features of bacterial UbiB that differ from human homologs offers a promising approach, potentially using the recombinant protein for high-throughput screening of compound libraries to identify selective inhibitors . Combination therapy approaches could pair UbiB inhibitors with conventional antibiotics to potentially overcome resistance mechanisms, as disrupting ubiquinone biosynthesis would compromise energy-dependent resistance systems like efflux pumps . Targeting UbiB might be particularly effective against hypervirulent K. pneumoniae strains that have been shown to rapidly acquire resistance to conventional antibiotics, including last-resort carbapenems . Alternative approaches could include developing small molecule inhibitors that disrupt protein-protein interactions between UbiB and other components of the ubiquinone biosynthetic machinery, potentially allowing for more selective targeting. The therapeutic potential of targeting ubiquinone biosynthesis is supported by the pathway's presence across many bacterial pathogens but requires careful consideration of potential side effects on mitochondrial function in host cells.

How does Klebsiella pneumoniae UbiB compare structurally and functionally to homologous proteins in other bacteria?

Klebsiella pneumoniae UbiB shares significant structural and functional characteristics with homologous proteins found across alpha-, beta-, and gammaproteobacterial clades, suggesting evolutionary conservation of ubiquinone biosynthesis mechanisms . Comparative genomic analyses reveal that the UbiB protein family is widely distributed among proteobacteria, including many human pathogens, indicating the fundamental importance of this protein for bacterial metabolism . The primary sequence typically contains conserved motifs associated with kinase-like functions, though UbiB likely acts as a hydroxylase or facilitates hydroxylation reactions rather than functioning as a true kinase. In E. coli, which serves as a model organism for studying ubiquinone biosynthesis, UbiB appears to work in concert with the monooxygenase UbiI in the oxygen-dependent pathway, while in the oxygen-independent pathway, it may functionally interact with the recently discovered UbiU-UbiV complex . Structural predictions suggest that UbiB contains nucleotide-binding domains that may be involved in cofactor binding, though the exact catalytic mechanism remains to be fully elucidated across different bacterial species.

What methodological approaches are best for studying the evolution of UbiB across bacterial species?

The most effective methodological approaches for studying UbiB evolution across bacterial species combine phylogenetic analysis, comparative genomics, and experimental validation of protein function. Researchers should begin with comprehensive sequence retrieval from diverse bacterial genomes, identifying UbiB homologs through both sequence similarity searches and genomic context analysis, as UbiB genes are often clustered with other ubiquinone biosynthesis genes . Multiple sequence alignment tools such as MUSCLE or MAFFT should be employed to align UbiB sequences, followed by phylogenetic tree construction using maximum likelihood or Bayesian methods to infer evolutionary relationships. Molecular clock analyses can provide temporal context for UbiB evolution, potentially correlating with major evolutionary transitions or environmental adaptations in bacterial lineages. Analysis of selective pressure through calculation of dN/dS ratios across different protein domains can identify regions under purifying or positive selection, providing insights into functionally critical versus adaptable regions of the protein. Experimental approaches including heterologous expression of UbiB orthologs from diverse species, followed by functional complementation studies in model organisms, can validate bioinformatic predictions about functional conservation or divergence.

What is known about the co-evolution of UbiB with other components of ubiquinone biosynthesis pathways?

Research on the co-evolution of UbiB with other components of ubiquinone biosynthesis pathways reveals complex evolutionary patterns reflecting adaptation to diverse bacterial lifestyles and environmental niches. Genomic context analysis shows that UbiB often clusters with other ubiquinone biosynthesis genes, suggesting co-regulation and functional cooperation, though the specific gene organization varies across bacterial lineages . The recent discovery of oxygen-independent ubiquinone biosynthesis pathways involving UbiU and UbiV proteins demonstrates that bacteria have evolved alternative solutions for ubiquinone production under different environmental conditions, with many species maintaining both oxygen-dependent and oxygen-independent pathways . This dual pathway maintenance likely reflects evolutionary adaptation to fluctuating oxygen environments encountered by bacteria during their lifecycle, particularly for facultative anaerobes like K. pneumoniae. Correlation analysis of gene presence/absence patterns across diverse bacterial genomes reveals that certain Ubi proteins appear to have co-evolved as functional units, suggesting they may form physical complexes or catalyze sequential steps in the pathway. The distribution of different ubiquinone biosynthesis pathways across bacterial phylogeny suggests multiple instances of horizontal gene transfer, potentially driven by selective advantages conferred by metabolic flexibility in certain ecological niches or host environments.

What are the most effective genetic manipulation techniques for studying UbiB function in Klebsiella pneumoniae?

The most effective genetic manipulation techniques for studying UbiB function in Klebsiella pneumoniae include both traditional and cutting-edge approaches tailored to this clinically significant pathogen. CRISPR-Cas9 genome editing represents the current gold standard for creating precise gene deletions, insertions, or point mutations in the ubiB gene, offering advantages in efficiency and specificity over traditional homologous recombination methods. For conditional expression studies, researchers should consider inducible promoter systems such as arabinose-inducible (PBAD) or tetracycline-responsive elements, which allow tight regulation of UbiB expression levels to study dose-dependent effects and avoid lethality issues if UbiB is essential. Complementation studies using plasmid-based expression of wild-type or mutant UbiB variants are crucial for validating phenotypes and structure-function relationships, ideally employing low-copy plasmids with native-like promoters to avoid artifacts from overexpression. Reporter gene fusions (such as ubiB-gfp) can provide valuable insights into protein localization and expression patterns under different growth conditions relevant to pathogenesis. For studying UbiB in the context of infection, signature-tagged mutagenesis or transposon sequencing (Tn-Seq) approaches can identify conditions where UbiB is particularly important for bacterial fitness or virulence.

How can researchers design experiments to elucidate the precise biochemical function of UbiB in the ubiquinone biosynthetic pathway?

Designing experiments to elucidate the precise biochemical function of UbiB requires a multi-faceted approach combining genetic, biochemical, and analytical methods. Researchers should begin with a comprehensive metabolite profiling experiment comparing wild-type and ubiB mutant strains using liquid chromatography-mass spectrometry (LC-MS) to identify accumulated intermediates in the mutant, which can indicate the specific biochemical step catalyzed by UbiB . In vitro reconstitution of ubiquinone biosynthesis reactions using purified recombinant UbiB protein and synthetic or isolated pathway intermediates as substrates can directly demonstrate enzymatic activity, though careful attention must be paid to provide any necessary cofactors such as flavins, iron-sulfur clusters, or electron donors . Protein-protein interaction studies employing techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or crosslinking mass spectrometry can identify other Ubi proteins that physically interact with UbiB, providing contextual information about its function within the larger biosynthetic complex. Site-directed mutagenesis targeting predicted catalytic residues followed by activity assays can validate mechanistic hypotheses and identify essential functional domains. Time-resolved spectroscopic techniques may capture transient reaction intermediates or conformational changes during catalysis, offering deep mechanistic insights into UbiB's role in ubiquinone biosynthesis.

What experimental controls are critical when working with recombinant UbiB protein to ensure valid results?

When working with recombinant UbiB protein, several critical experimental controls must be implemented to ensure valid and reproducible results. A catalytically inactive UbiB mutant (created by site-directed mutagenesis of predicted catalytic residues) serves as an essential negative control to distinguish specific enzymatic activity from non-specific effects or contaminating activities in protein preparations . Multiple expression systems (E. coli, yeast, baculovirus, or mammalian cells) should be compared to identify potential system-specific artifacts and ensure native-like folding and activity of the recombinant protein . Researchers must verify protein purity through multiple methods, including SDS-PAGE, size exclusion chromatography, and mass spectrometry, to ensure observed activities are attributable to UbiB rather than contaminants. For activity assays, substrate specificity controls using structurally related but non-physiological substrates help define the enzyme's true specificity, while time-course and enzyme concentration dependence studies establish the kinetic parameters and confirm reaction linearity. When studying UbiB in the context of oxygen-dependent or independent pathways, parallel experiments under strictly controlled oxygen conditions with appropriate positive controls (known oxygen-dependent and independent enzymes) are essential for valid comparisons . Finally, researchers should confirm that any added affinity tags do not interfere with activity by comparing tagged versus untagged protein or proteins with tags at different positions.

How can researchers accurately quantify ubiquinone and its biosynthetic intermediates when studying UbiB function?

Accurate quantification of ubiquinone and its biosynthetic intermediates requires sophisticated analytical approaches tailored to these hydrophobic compounds. High-performance liquid chromatography (HPLC) coupled with multiple detection methods provides the foundation for analysis, with reversed-phase C18 columns effectively separating ubiquinone and intermediates based on their hydrophobicity. Ultraviolet-visible (UV-Vis) detection at characteristic wavelengths (275 nm for ubiquinone) offers basic quantification capabilities, while electrochemical detection provides enhanced sensitivity for redox-active compounds in the pathway. For comprehensive analysis, liquid chromatography-mass spectrometry (LC-MS) using multiple reaction monitoring (MRM) offers superior sensitivity and specificity, allowing accurate identification and quantification of multiple intermediates simultaneously. Sample preparation is critical and should include efficient extraction protocols using appropriate organic solvents (typically hexane/ethanol mixtures) followed by solid-phase extraction cleanup steps to remove interfering compounds from bacterial cultures. Researchers must prepare calibration curves using authenticated standards for each compound of interest, ideally employing stable isotope-labeled internal standards to correct for matrix effects and extraction variability. For challenging intermediates without commercial standards, researchers may need to synthesize standards or use semi-quantitative approaches based on structural analogs with similar chemical properties.

What are the common pitfalls in interpreting phenotypic data from UbiB mutant studies, and how can they be avoided?

Common pitfalls in interpreting phenotypic data from UbiB mutant studies include overlooking pleiotropic effects, misattributing direct versus indirect consequences, and failing to account for compensatory mechanisms. Since ubiquinone is crucial for respiration, ubiB mutations may cause broad metabolic perturbations beyond the direct biochemical defect, potentially leading to secondary phenotypes not directly related to UbiB's specific function . To avoid misinterpretation, researchers should implement comprehensive metabolomic profiling to distinguish primary from secondary metabolic effects. Genetic complementation studies are essential but must use physiologically relevant expression levels, as overexpression can mask subtle phenotypes or create artificial suppression effects. Researchers frequently neglect the possibility of suppressor mutations arising during mutant construction or characterization, which can be addressed through whole-genome sequencing of adapted mutant strains and construction of multiple independent mutants. The potential for functional redundancy or alternative pathways (particularly the oxygen-independent pathway) may obscure phenotypes in single-gene studies, necessitating combinatorial mutation approaches targeting multiple related genes . Finally, growth conditions dramatically influence ubiquinone-related phenotypes, so experiments should be conducted under various relevant conditions (aerobic, anaerobic, different carbon sources) to comprehensively characterize the mutant.

How can contradictory findings about UbiB function from different experimental approaches be reconciled?

Reconciling contradictory findings about UbiB function from different experimental approaches requires systematic analysis of methodological differences and underlying assumptions. Researchers should begin by comparing the genetic backgrounds used across studies, as strain-specific differences in metabolism or the presence of suppressor mutations can significantly alter observed phenotypes. Detailed examination of experimental conditions is crucial, as factors such as oxygen availability, growth phase, media composition, and temperature can dramatically influence ubiquinone metabolism and potentially lead to apparently contradictory results . For biochemical studies showing discrepancies, differences in protein preparation methods (including tags, purification protocols, and storage conditions) may affect protein activity or stability, warranting standardized side-by-side comparisons using multiple assay systems. Kinetic considerations are frequently overlooked; phenomena observed at different time points may appear contradictory but actually represent different phases of a dynamic process. To systematically address contradictions, researchers should design experiments that directly test competing hypotheses under identical conditions, potentially combining approaches (e.g., genetic and biochemical) within the same experimental framework. Collaborative research involving laboratories with complementary expertise can be particularly valuable for resolving methodological discrepancies, as can the application of new technologies that overcome limitations of previous approaches.

What are the most promising unexplored aspects of UbiB function that warrant further investigation?

The most promising unexplored aspects of UbiB function warranting further investigation include its potential regulatory roles beyond catalytic activity in ubiquinone biosynthesis. While UbiB is generally considered to participate in hydroxylation reactions, its precise biochemical mechanism remains incompletely characterized, with structural studies of the protein potentially revealing novel catalytic mechanisms or unexpected substrate interactions . The potential role of UbiB in coordinating the transition between oxygen-dependent and oxygen-independent ubiquinone biosynthesis pathways represents an intriguing area for investigation, potentially involving protein-protein interactions or post-translational modifications that modulate its activity in response to changing oxygen levels . Studies exploring UbiB's potential moonlighting functions outside of ubiquinone biosynthesis might reveal unexpected connections to other cellular processes, as has been observed for several metabolic enzymes. The regulation of UbiB at transcriptional, translational, and post-translational levels remains largely unexplored, with potential implications for understanding how bacteria modulate ubiquinone production during different growth phases or stress conditions. Finally, comparative studies of UbiB across diverse bacterial species, particularly comparing pathogenic and non-pathogenic strains, could reveal adaptations specific to virulence or host colonization.

How might emerging technologies advance our understanding of UbiB and ubiquinone biosynthesis?

Emerging technologies offer transformative potential for advancing our understanding of UbiB and ubiquinone biosynthesis through unprecedented resolution at molecular, cellular, and systems levels. Cryo-electron microscopy (cryo-EM) is revolutionizing structural biology, potentially enabling visualization of entire ubiquinone biosynthetic complexes including UbiB in near-native states, revealing dynamic interactions previously inaccessible to traditional structural approaches . Single-molecule techniques including fluorescence resonance energy transfer (FRET) and high-speed atomic force microscopy could capture conformational changes in UbiB during catalysis, providing insights into reaction mechanisms and regulatory dynamics. For in vivo studies, advances in metabolic labeling combined with click chemistry allow selective tagging and tracking of ubiquinone intermediates in living cells, potentially revealing spatiotemporal aspects of biosynthesis. CRISPR interference (CRISPRi) and CRISPR activation (CRISPRa) technologies enable tunable repression or enhancement of ubiB expression, allowing dose-dependent studies without complete gene deletion. Systems biology approaches integrating multi-omics data (transcriptomics, proteomics, metabolomics) with machine learning algorithms can reveal previously unrecognized regulatory networks controlling ubiquinone biosynthesis under different conditions. Finally, microfluidic devices coupled with real-time imaging allow precise manipulation of microenvironments, particularly oxygen gradients, potentially revealing how UbiB function adapts to dynamic conditions relevant to infection settings.

What interdisciplinary approaches could yield breakthrough insights into UbiB's role in bacterial physiology and pathogenesis?

Interdisciplinary approaches combining expertise across multiple scientific domains offer the greatest potential for breakthrough insights into UbiB's role in bacterial physiology and pathogenesis. Integrating structural biology with computational chemistry through molecular dynamics simulations and quantum mechanical calculations could elucidate the precise catalytic mechanism of UbiB at atomic resolution, potentially identifying novel targetable features for antimicrobial development . Synthetic biology approaches including the reconstitution of minimal ubiquinone biosynthetic pathways in heterologous hosts or cell-free systems would allow systematic dissection of component interactions and pathway regulation without the complexity of the native cellular environment. Combining bacterial genetics with advanced imaging techniques such as correlative light and electron microscopy could reveal the spatial organization of UbiB within bacterial membranes and its potential co-localization with other respiratory complexes. Infection biology perspectives integrating in vitro studies with animal models and clinical isolate analysis could establish connections between UbiB function and pathogenesis in relevant host environments . Systems pharmacology approaches systematically testing interactions between UbiB inhibitors and existing antibiotics might reveal synergistic combinations effective against drug-resistant strains. Finally, evolutionary biology frameworks examining UbiB sequence and function across diverse bacterial phyla could reveal adaptation patterns related to different ecological niches and host interactions, potentially identifying pathogen-specific features suitable for targeted therapeutic development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.