Recombinant Klebsiella pneumoniae Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Physiology

GlpG mediates membrane protein quality control by selectively cleaving orphan subunits of respiratory complexes :

  • Substrate Specificity: Preferentially hydrolyzes non-functional transmembrane proteins, such as orphan components of hydrogenase-2 (HybA) and formate dehydrogenases (FdnH, FdoH) .

  • Cleavage Mechanism:

    • Requires destabilizing residues (e.g., proline) in substrate TMDs .

    • Cleaves at glycine residues (e.g., Gly²⁹⁶ in HybA) .

    • Initial cleavage licenses subsequent proteolytic degradation, preventing toxic aggregation .

Production and Purification

Commercial variants are optimized for stability and activity :

ParameterSpecification
Expression HostE. coli
Purification TagHis tag (N-terminal)
Purity>95% (SDS-PAGE)
Storage-20°C in Tris buffer (pH 7.4) with 20% glycerol

4.1. Role in Respiratory Complex Regulation

GlpG ensures fidelity of respiratory complexes by degrading unassembled subunits:

  • HybA (hydrogenase-2 subunit) is cleaved only when orphaned, not when incorporated into functional complexes .

  • Mutation of TMD proline (HybAᴾ³⁰⁰ᴬ) renders the substrate resistant to GlpG .

4.2. Impact on Bacterial Fitness

  • In Escherichia coli ExPEC strains, GlpG promotes gut colonization by regulating glycerol and fatty acid metabolism .

  • Disruption of glpG reduces bacterial survival in murine intestinal models, highlighting its role in nutrient utilization .

Applications in Research

  • Enzymatic Studies: Used to investigate rhomboid protease kinetics and substrate recognition .

  • Membrane Protein Dynamics: A tool to study quality control mechanisms in prokaryotic systems .

  • Therapeutic Target Exploration: Potential antibiotic target due to its role in bacterial persistence .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: Our proteins are typically shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
glpG; KPK_0324; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Klebsiella pneumoniae (strain 342)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVAQAFVDYMATQGIILTIQQHAQSDVWLADESQAGRVRAELARFLENPA DPRYLAASWQSGQTNSGLRYQRFPFFATLRHNAGPFTWAILLICIAVFILQNLLGDQPVM IWLAWPYDPSLQFEAWRYFSHAFMHFSLMHILFNLLWWWYLGGAVEKRIGSGKLVVITVI SALLSGFVQHQFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLILFSLVWLIAG WFDVFGMAIANGAHVAGLATGLAMAFVDTLHGRKRA
Uniprot No.

Target Background

Function
Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Database Links

KEGG: kpe:KPK_0324

Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Klebsiella pneumoniae Rhomboid protease GlpG?

Klebsiella pneumoniae Rhomboid protease GlpG is an intramembrane serine protease that belongs to the rhomboid family of proteases. The full-length protein consists of 276 amino acids (positions 1-276) with a catalytic dyad of serine and histidine residues. GlpG functions primarily in membrane protein quality control by targeting and cleaving orphan components of protein complexes when they are not incorporated into functional assemblies . The protein can be recombinantly expressed with tags (such as His-tag) for research purposes, typically using E. coli expression systems .

How is recombinant K. pneumoniae GlpG typically stored and reconstituted?

For optimal stability and activity, recombinant K. pneumoniae GlpG requires specific storage and reconstitution conditions:

ParameterRecommendation
Storage temperature-20°C to -80°C upon receipt
AliquotingNecessary for multiple use to avoid freeze-thaw cycles
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Glycerol addition5-50% (final concentration), 50% being standard
Working aliquotsStore at 4°C for up to one week

Repeated freeze-thaw cycles should be avoided as they can compromise the structural integrity and enzymatic activity of the protein .

What is the catalytic mechanism of rhomboid proteases like GlpG?

Rhomboid proteases like GlpG employ a catalytic dyad (Ser/His) rather than the classical serine protease catalytic triad. In E. coli GlpG (homologous to K. pneumoniae GlpG), these residues are Ser201 and His254. The catalytic serine is positioned approximately 10 Å below the membrane surface, allowing for intramembrane proteolysis of substrate transmembrane domains (TMDs) .

The proteolytic mechanism follows these key steps:

  • Formation of an "interrogation complex" when the substrate TMD engages with GlpG

  • Transition to a "scission complex" requiring unwinding of the substrate TMD

  • Helix-destabilizing residues (like prolines) in the substrate TMD facilitate unwinding

  • Cleavage occurs, typically with specific residue preferences at the P1 position

This mechanism is rate-driven rather than affinity-driven, with the enzymatic efficiency being deliberately low (kcat≈0.006/s) to prevent indiscriminate proteolysis of membrane proteins .

How does GlpG select its protein substrates?

GlpG exhibits remarkable substrate selectivity through several mechanisms:

  • Orphan protein targeting: GlpG primarily recognizes and cleaves "orphan" components of protein complexes that aren't assembled into functional structures. When proteins are incorporated into their native complexes, their potential cleavage sites become protected .

  • TMD recognition: Substrate TMDs must contain helix-destabilizing residues (like prolines) that enable unwinding during the formation of the scission complex .

  • P1 residue preference: GlpG shows selectivity for specific amino acids at the P1 position (the C-terminal residue generated upon cleavage), with small amino acids like glycine being preferred. Substitution with bulky residues (e.g., G296F mutation in HybA) prevents cleavage .

  • Conformational interrogation: Before cleavage, GlpG "interrogates" potential substrates for structural instability in their TMDs, only proceeding to the scission complex if unwinding is feasible .

These mechanisms ensure that only appropriate substrates are cleaved, protecting functional membrane protein complexes from inappropriate degradation.

What expression systems are recommended for recombinant K. pneumoniae GlpG production?

For recombinant production of K. pneumoniae GlpG, E. coli expression systems are most commonly employed. When designing expression systems, consider:

  • Vector selection: Plasmids with tunable promoters (like pBAD or pET systems) allow controlled expression

  • Tag placement: His-tags at the N-terminus facilitate purification while minimally affecting activity

  • Expression strain: E. coli strains lacking endogenous rhomboid proteases can help avoid interference

  • Induction conditions: Typically 0.2% arabinose (for pBAD systems) for 2-3 hours at 37°C

For experimental verification of GlpG activity in cellular contexts, complementary approaches using chromosomal and plasmid-encoded expression can be implemented, as demonstrated in studies with GlpG homologs .

How can we assess rhomboid protease activity in experimental settings?

Several approaches can be used to assess GlpG activity:

A. In vivo cleavage assays:

  • Express potential substrates with detection tags (e.g., sfCherry-3xFLAG)

  • Co-express active or inactive (S201A mutant) GlpG

  • Detect cleavage products via Western blotting

  • Compare substrate processing between active and inactive GlpG conditions

B. Substrate identification:

  • Generate a library of potential TMD substrates

  • Express each candidate with active or inactive GlpG

  • Define positive hits when more cleavage product and less full-length substrate are observed with active enzyme

  • Validate with full-length protein substrates under appropriate growth conditions (e.g., anaerobic for respiratory complex components)

C. Mapping cleavage sites:

  • Isolate cleavage products

  • Perform N-terminal sequencing to identify the P1 residue

  • Create P1 mutants (e.g., G296F in HybA) to confirm the cleavage site

How is GlpG involved in membrane protein quality control?

GlpG functions as a specialized quality control protease through a coordinated process:

  • Selective targeting: GlpG specifically recognizes orphan components of protein complexes, especially those from respiratory complexes like hydrogenase-2 (Hyd-2) and formate dehydrogenases .

  • Initial processing: GlpG performs the initial cleavage of orphan membrane proteins, which serves as a licensing step for subsequent degradation .

  • Secondary degradation: After GlpG cleavage, other proteases further degrade the cleaved products, preventing accumulation of potentially harmful protein fragments .

  • Functional complex protection: Importantly, GlpG does not cleave proteins when they are incorporated into functional complexes, ensuring that proper assemblies remain intact. This is demonstrated by GlpG having no effect on Hyd-2 activity under normal growth conditions .

  • Stress response enhancement: Quality control by GlpG becomes particularly important during stress conditions. For instance, further degradation of FdnH and FdoH (both possessing 4Fe-4S clusters) is observed following copper stress, which can damage Fe-S clusters .

This integrated quality control system helps maintain membrane protein homeostasis and prevents the accumulation of potentially toxic orphan membrane proteins.

What are the structural features of rhomboid proteases that contribute to their function?

Rhomboid proteases like GlpG exhibit distinctive structural features critical to their function:

  • Core structure: The core structure consists of six transmembrane segments (TM1-TM6) arranged to create a compact fold .

  • Catalytic machinery: The catalytic dyad (Ser201/His254 in E. coli GlpG) is embedded approximately 10 Å below the membrane surface, positioning it for intramembrane proteolysis .

  • Substrate-binding cavity: A submerged active site serves as the substrate-binding cavity, which is accessible through a lateral gate between TM2 and TM5 .

  • Additional domains: Some rhomboid proteases, like Rhom7, contain a 7th transmembrane domain and additional N-terminal or C-terminal domains that may contribute to substrate recognition or regulation, though the 7th TMD is often dispensable for basic proteolytic activity .

  • Membrane mobility: Rhomboids are among the most rapidly diffusing proteins within lipid bilayers, allowing them to patrol membranes in search of substrates .

These structural features collectively enable the controlled intramembrane proteolysis essential for quality control while preventing indiscriminate cleavage.

What are the known substrates of bacterial rhomboid proteases like GlpG?

The identification of physiological substrates for bacterial rhomboid proteases has been challenging, but several have been confirmed:

SubstrateComplexFunctionCleaved byCleavage characteristic
HybAHydrogenase-2 (Hyd-2)Respiratory complex componentGlpG, Rhom7P1 residue: Gly296
HybOHydrogenase-2 (Hyd-2)Respiratory complex componentGlpG, Rhom7*Cleavage detection complicated by similar-sized band
FdoHFormate dehydrogenase ORespiratory complex componentGlpGFurther degradation observed after copper stress
FdnHFormate dehydrogenase NRespiratory complex componentRhom7Further degradation observed after copper stress
YqjD-Ribosome-associated proteinGlpG-
YtjC-Putative phosphataseGlpG-

*Cleavage demonstrated for TMD but difficult to confirm for full-length protein due to detection limitations.

These substrates share common features including transmembrane domains with helix-destabilizing residues and appropriate P1 residues .

How might rhomboid proteases be involved in antimicrobial resistance in K. pneumoniae?

While direct evidence linking GlpG to antimicrobial resistance in K. pneumoniae is limited in the provided search results, several potential connections can be hypothesized based on known functions:

  • Membrane protein homeostasis: GlpG's role in quality control of membrane proteins could influence the stability and function of transporters or enzymes involved in drug efflux or modification .

  • Stress response: Given that GlpG activity on certain substrates (like FdnH and FdoH) increases under stress conditions, it may play a role in adaptive responses to antibiotic exposure .

  • Respiratory chain modulation: GlpG targets components of respiratory complexes, potentially allowing metabolic adaptations that could contribute to persister cell formation or tolerance to certain antibiotics .

  • Biofilm formation: Changes in membrane protein composition influenced by GlpG activity might affect bacterial surface properties relevant to biofilm formation, a known contributor to antibiotic resistance .

Future research should directly investigate whether GlpG activity affects minimum inhibitory concentrations of antibiotics, expression of resistance genes, or survival during antibiotic treatment.

What experimental challenges must be addressed when studying rhomboid proteases?

Researchers face several significant challenges when investigating rhomboid proteases like K. pneumoniae GlpG:

  • Conditional expression of substrates: Many substrates are only expressed under specific conditions (e.g., low oxygen environments for HybA and FdnH), necessitating careful experimental design to capture physiological activity .

  • Partner protein interference: Potential substrates may be protected from cleavage by interaction with partner proteins in functional complexes, making substrate identification in standard conditions difficult .

  • Membrane protein solubilization: As integral membrane proteins, both rhomboid proteases and their substrates present challenges for purification and biochemical analysis while maintaining native structure and activity.

  • Detection limitations: Cleavage products may be rapidly degraded or difficult to distinguish from background bands (as observed with HybO), complicating direct detection of proteolytic activity .

  • Subtle phenotypes: Since GlpG selectively targets non-functional proteins, deletion mutants might not display robust phenotypes under standard laboratory conditions .

These challenges explain why the identification of rhomboid substrates in bacteria has been difficult, requiring sophisticated approaches that consider growth conditions, partner proteins, and sensitive detection methods.

How do rhomboid proteases from different bacterial species compare?

Bacterial rhomboid proteases show interesting evolutionary patterns and functional diversification:

  • Structural conservation: The core six-transmembrane structure is highly conserved across bacterial rhomboids, with the catalytic dyad (Ser/His) positioned similarly in the membrane .

  • Functional specialization: While K. pneumoniae and E. coli GlpG share high homology and likely similar functions in quality control, other bacterial rhomboids like Providencia stuartii AarA have evolved distinct roles in quorum sensing .

  • Domain variations: Some bacterial rhomboids, like Shigella sonnei Rhom7, contain additional TMDs and terminal domains that might confer specialized functions or regulatory properties .

  • Substrate preferences: Even closely related rhomboids can show distinct substrate preferences. For example, S. sonnei GlpG and Rhom7 have overlapping but non-identical substrate profiles, with Rhom7 cleaving FdnH while GlpG does not .

  • Abundance and distribution: Rhomboid proteases are found across diverse bacterial lineages, suggesting their fundamental importance in prokaryotic physiology despite functional adaptations to different ecological niches .

This evolutionary diversity highlights the adaptability of the rhomboid protease fold to serve various functions while maintaining core mechanistic features.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.