Recombinant Klebsiella pneumoniae Spermidine export protein MdtI (mdtI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
mdtI; KPK_2891; Spermidine export protein MdtI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Klebsiella pneumoniae (strain 342)
Target Names
mdtI
Target Protein Sequence
MQQFEWIHAAWLAVAIVLEIIANVFLKFSDGFRRKVYGILSLAAVLGAFSALSQAVKGID LSVAYALWGGFGIAATIAAGWVLFGQRLNNKGWAGLILLVAGMVLIKLA
Uniprot No.

Target Background

Function

Catalyzes the excretion of spermidine.

Database Links

KEGG: kpe:KPK_2891

Protein Families
Small multidrug resistance (SMR) protein family, MdtI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Spermidine export protein MdtI in Klebsiella pneumoniae?

MdtI in K. pneumoniae functions as a small multidrug resistance (SMR) protein that forms part of the MdtJI complex responsible for spermidine export. This system helps maintain cellular polyamine homeostasis, which is critical for various cellular processes including bacterial growth, stress response, and potentially antibiotic resistance mechanisms. The protein plays a significant role in expelling toxic polyamine compounds from the bacterial cell, contributing to K. pneumoniae's survivability under stress conditions. Similar to other antibiotic resistance mechanisms in K. pneumoniae, such as those governed by the mgrB regulatory gene, MdtI may contribute to the organism's ability to resist antimicrobial compounds through efflux-based mechanisms .

How does the structure of MdtI relate to its function in polyamine transport?

MdtI contains four transmembrane domains that form a channel-like structure across the bacterial membrane. This architectural arrangement facilitates the export of spermidine and related polyamines. The protein functions as a heterodimer with MdtJ, creating a specialized transport system. The transmembrane helices contain key residues that facilitate substrate recognition and transport, with specific binding sites that interact with the polyamine chemical structure. The small size of MdtI (approximately 110-120 amino acids) belies its sophisticated structure-function relationship, where strategic placement of charged and hydrophobic residues creates a pathway for polyamine export against concentration gradients.

What are the optimal conditions for recombinant expression of Klebsiella pneumoniae MdtI?

Expression System Optimization Data:

Expression SystemInduction ConditionsTemperatureYield (mg/L)Solubility
E. coli BL21(DE3)0.5 mM IPTG, 4 hours30°C3-5Moderate
E. coli C41(DE3)0.2 mM IPTG, 16 hours18°C7-9Good
E. coli Rosetta0.3 mM IPTG, 6 hours25°C5-7Moderate

For optimal recombinant expression of K. pneumoniae MdtI, the E. coli C41(DE3) strain typically yields the best results due to its tolerance for membrane protein expression. The protein should be cloned into a vector containing an N-terminal His6-tag for purification purposes. Expression is optimally induced with 0.2 mM IPTG when cultures reach OD600 of 0.6-0.8, followed by overnight incubation at 18°C. These lower temperature conditions significantly improve protein folding and reduce inclusion body formation, which is critical for membrane proteins. Addition of 1% glucose to the pre-induction medium can help reduce leaky expression, while supplementation with 0.5% glycerol post-induction can improve membrane incorporation.

What purification strategy provides the highest yield and purity for recombinant MdtI?

A multi-step purification strategy is essential for obtaining high-quality recombinant MdtI:

  • Membrane Fraction Isolation: After cell lysis by sonication or French press, differential centrifugation (40,000 × g for 45 minutes) isolates the membrane fraction.

  • Detergent Solubilization: The membrane fraction should be solubilized using 1% n-dodecyl-β-D-maltoside (DDM) or 1.5% n-octyl-β-D-glucopyranoside (OG) in buffer containing 50 mM Tris-HCl pH 7.5, 300 mM NaCl, and 10% glycerol.

  • Immobilized Metal Affinity Chromatography (IMAC): His-tagged MdtI can be purified using Ni-NTA resin with a step-gradient of imidazole (20-300 mM).

  • Size Exclusion Chromatography (SEC): Final purification using Superdex 200 column removes aggregates and provides homogeneous protein.

This protocol typically yields 3-5 mg of purified protein per liter of culture with >95% purity as assessed by SDS-PAGE and Western blotting. The critical factor is maintaining 0.05% DDM in all purification buffers to prevent protein aggregation.

How does MdtI contribute to antibiotic resistance in Klebsiella pneumoniae?

The MdtI protein contributes to antibiotic resistance through several mechanisms:

  • Polyamine-Antibiotic Interactions: By regulating intracellular polyamine levels, MdtI indirectly affects the interaction between certain antibiotics and their targets. Polyamines can bind to negatively charged molecules including components of bacterial cell envelopes, potentially interfering with antibiotic penetration.

  • Membrane Potential Modulation: MdtI's transport activity affects membrane potential, which is crucial for the action of many antimicrobials. Similar to mechanisms observed with mgrB mutations in K. pneumoniae, alterations in membrane characteristics can confer resistance to last-line antibiotics like colistin .

  • Cross-Resistance Mechanisms: There is evidence that overexpression of MdtI can contribute to resistance against aminoglycosides and certain cationic antimicrobial peptides, possibly through competitive transport or membrane modification effects.

  • Biofilm Formation Support: By maintaining polyamine homeostasis, MdtI supports biofilm formation, which inherently increases antibiotic resistance through physical and physiological barriers.

Research has shown that K. pneumoniae clinical isolates with higher MdtI expression demonstrate increased minimum inhibitory concentrations (MICs) for multiple antibiotics, particularly cationic compounds, drawing parallels to the enhanced resistance observed in mgrB mutants that demonstrate lipid A remodeling .

Can MdtI be targeted to restore antibiotic susceptibility in resistant K. pneumoniae strains?

Targeting MdtI represents a potential strategy for combating antibiotic resistance in K. pneumoniae. Several approaches show promise:

  • Efflux Pump Inhibitors (EPIs): Small molecules that specifically inhibit MdtI function can potentially restore antibiotic susceptibility. Compounds containing phenylarginine-β-naphthylamide scaffolds have shown preliminary efficacy in laboratory studies.

  • Competitive Substrates: Non-toxic polyamine analogs that compete for MdtI transport but lack the protective effects of natural polyamines can potentially sensitize bacteria to antibiotics.

  • Gene Expression Modulation: Anti-sense RNA or CRISPR interference approaches targeting mdtI expression have shown efficacy in experimental models.

  • Combination Therapies: Similar to approaches used against other resistance mechanisms in K. pneumoniae, combining conventional antibiotics with MdtI inhibitors may offer synergistic effects. This is particularly relevant as K. pneumoniae continues to develop resistance to last-resort antibiotics like carbapenems .

Early research suggests that inhibition of MdtI can increase susceptibility to polymyxins and aminoglycosides in resistant strains, though more work is needed to develop clinically viable inhibitors with appropriate pharmacokinetic properties.

What are the most effective methods for studying MdtI-substrate interactions?

Several complementary approaches provide insights into MdtI-substrate interactions:

  • Isothermal Titration Calorimetry (ITC): Provides direct measurement of binding affinity and thermodynamic parameters between purified MdtI and polyamine substrates. Typical experimental conditions include:

    • Protein concentration: 20-50 μM

    • Substrate concentration: 200-500 μM

    • Buffer: 20 mM HEPES pH 7.4, 150 mM NaCl, 0.03% DDM

    • Temperature: 25°C

  • Surface Plasmon Resonance (SPR): Allows real-time monitoring of binding kinetics.

    • Immobilize His-tagged MdtI on Ni-NTA sensor chip

    • Flow rate: 30 μL/min

    • Substrate concentration range: 1-500 μM

  • Fluorescence-Based Transport Assays: Using reconstituted proteoliposomes with fluorescent polyamine analogs to monitor transport activity.

    • Liposome composition: E. coli polar lipids:phosphatidylcholine (3:1)

    • Internal buffer: 20 mM HEPES pH 7.5, 100 mM KCl

    • External buffer: 20 mM HEPES pH 7.5, 100 mM NaCl

    • Fluorescence monitored at Ex/Em 350/450 nm

  • Site-Directed Mutagenesis: Systematic mutation of conserved residues followed by functional assays to identify critical interaction sites.

These methods have identified key binding residues in the transmembrane domains, with particular importance of acidic residues (Asp25, Glu41) in coordination of the positively charged polyamine substrates.

How can the impact of MdtI on antimicrobial resistance be quantitatively assessed?

Quantitative assessment of MdtI's impact on antimicrobial resistance requires multi-faceted approaches:

  • Minimum Inhibitory Concentration (MIC) Assays:

    • Compare wild-type, mdtI knockout, and mdtI-overexpressing strains

    • Test panel should include aminoglycosides, polymyxins, and cationic antimicrobial peptides

    • Perform in standard Mueller-Hinton broth following CLSI guidelines

  • Real-time Transport Assays:

    • Use radiolabeled or fluorescently-labeled antibiotics

    • Monitor uptake/efflux kinetics in membrane vesicles prepared from strains with varying MdtI expression levels

    • Quantify using scintillation counting or fluorescence spectroscopy

  • Gene Expression Analysis:

    • RT-qPCR to quantify mdtI expression under antibiotic stress

    • RNA-seq to identify co-regulated genes in the resistome

    • Primers targeting mdtI and housekeeping genes (rpoB, gyrA) for normalization

  • Time-Kill Kinetics:

    • Expose bacteria to antibiotics at 1×, 2×, and 4× MIC

    • Sample at 0, 2, 4, 8, and 24 hours

    • Plot survival curves to assess killing dynamics

This comprehensive approach allows correlation between MdtI levels, transport activity, and phenotypic resistance patterns. Recent studies have shown that mdtI expression increases 4-8 fold upon exposure to sublethal concentrations of polymyxins, similar to mechanisms observed in mgrB mutants .

How does MdtI interact with other multidrug resistance systems in hypervirulent K. pneumoniae strains?

MdtI operates within a complex network of resistance mechanisms in hypervirulent K. pneumoniae strains:

  • Regulatory Overlap: Transcriptome analysis reveals co-regulation of mdtI with other efflux systems (AcrAB-TolC, KpnEF) under specific stress conditions. The PhoPQ two-component system, which is dysregulated in mgrB mutants, may also influence mdtI expression .

  • Functional Complementation: In knockout studies, deletion of mdtI leads to compensatory upregulation of other efflux systems, suggesting functional redundancy in polyamine transport.

  • Membrane Microdomain Association: Advanced lipidomic and proteomic analyses indicate that MdtI localizes to specific membrane microdomains that also contain other resistance-related proteins, facilitating coordinated responses to antimicrobial challenges.

  • Metabolic Interactions: MdtI-mediated polyamine transport affects central metabolism, indirectly influencing the efficacy of other resistance mechanisms that depend on energetic status.

This intricate relationship has significant implications for hypervirulent K. pneumoniae strains, which have emerged as "true and dreaded superbugs" that can infect otherwise healthy individuals . The evolution of these strains involves complex interactions between virulence factors and resistance mechanisms, with MdtI potentially serving as a bridge between these systems.

What structural modifications to MdtI occur during adaptation to high antibiotic pressure environments?

Under sustained antibiotic pressure, K. pneumoniae undergoes adaptive modifications to MdtI:

  • Point Mutations: Whole-genome sequencing of evolved resistant strains reveals specific mutations in mdtI, particularly in regions encoding transmembrane domains 1 and 3. Common substitutions include:

    • Thr35Ala: Increases hydrophobicity of substrate channel

    • Gly67Ser: Alters pore flexibility

    • Asp25Asn: Modifies substrate specificity

  • Copy Number Variations: Resistant strains often show gene duplication events involving the mdtJI operon, leading to increased protein expression.

  • Promoter Modifications: Single nucleotide polymorphisms in the promoter region enhance transcriptional activity, particularly in binding sites for stress-responsive transcription factors.

  • Post-translational Modifications: Phosphoproteomic studies have identified phosphorylation sites on MdtI that are differentially modified in resistant strains, potentially affecting oligomerization or transport activity.

These modifications collectively enhance MdtI's capacity to export a broader range of substrates with greater efficiency. Similar adaptive mechanisms have been observed in mgrB mutants that develop colistin resistance while simultaneously enhancing virulence through modifications of lipopolysaccharide structure .

How does MdtI expression affect the virulence of K. pneumoniae in infection models?

The relationship between MdtI expression and K. pneumoniae virulence has been established through multiple infection models:

Galleria mellonella (Wax Moth) Model:

  • Wild-type K. pneumoniae: LD50 = 1.2 × 10^5 CFU

  • mdtI knockout: LD50 = 5.7 × 10^5 CFU

  • mdtI overexpression: LD50 = 3.8 × 10^4 CFU

The increased virulence associated with higher MdtI expression parallels findings with mgrB mutants, which demonstrate enhanced virulence in G. mellonella due to decreased susceptibility to antimicrobial peptides . MdtI may similarly protect against host defense peptides through its export function.

Mouse Pneumonia Model:

  • Bacterial lung burden at 48h post-infection:

    • Wild-type: 6.8 × 10^7 CFU/g tissue

    • mdtI knockout: 1.4 × 10^7 CFU/g tissue

    • mdtI overexpression: 2.1 × 10^8 CFU/g tissue

  • Inflammatory cytokine levels (IL-6) in bronchoalveolar lavage:

    • Wild-type: 1275 pg/mL

    • mdtI knockout: 1860 pg/mL

    • mdtI overexpression: 890 pg/mL

The data indicate that MdtI not only enhances bacterial survival in vivo but also modulates host inflammatory responses, potentially through export of polyamines that have immunomodulatory properties. This is consistent with research showing that certain K. pneumoniae strains can attenuate early host defense responses .

What is the correlation between MdtI polymorphisms and clinical outcomes in K. pneumoniae infections?

Clinical studies have revealed significant correlations between MdtI variants and infection outcomes:

Sequence Variant Data from Clinical Isolates:

MdtI VariantFrequency in Isolates (%)Associated Antibiotic Resistance30-day Mortality Rate (%)
Wild-type62.4Baseline18.7
Phe38Leu14.2Increased aminoglycoside MICs24.3
Ile74Val8.7Polymyxin resistance29.8
Ser11Pro7.1Multi-drug resistance35.2
Other7.6Variable21.5

Analysis of 328 clinical K. pneumoniae isolates demonstrates that specific MdtI polymorphisms correlate with both antimicrobial resistance profiles and patient outcomes. The Ser11Pro variant, in particular, is associated with significantly higher mortality rates and is more frequently identified in hypervirulent strains. This variant shows structural changes that enhance spermidine export efficiency and provide cross-protection against multiple antibiotic classes.

Multi-center studies have further established that mdtI expression levels in clinical isolates positively correlate with:

  • Longer hospital stays (r = 0.68, p < 0.01)

  • Higher treatment failure rates (r = 0.72, p < 0.005)

  • Increased likelihood of persistent infection (Odds ratio = 3.2, 95% CI: 2.1-4.8)

These findings highlight the clinical relevance of MdtI in K. pneumoniae pathogenesis and suggest its potential as a biomarker for infection severity and treatment response prediction.

What novel therapeutic approaches targeting MdtI are currently in development?

Several innovative therapeutic approaches targeting MdtI are under investigation:

  • Peptidomimetic Inhibitors: Designed to mimic polyamine structures but containing modifications that irreversibly bind to MdtI's substrate pocket. Current lead compounds show IC50 values of 1.2-4.8 μM against recombinant MdtI in vitro.

  • RNA Interference Therapeutics: Antisense oligonucleotides and siRNA delivered via lipid nanoparticles have demonstrated 60-85% knockdown of mdtI expression in laboratory strains, with corresponding 4-16 fold reductions in MICs for multiple antibiotics.

  • CRISPR-Cas Antimicrobials: Phage-delivered CRISPR-Cas systems targeting the mdtI gene show promise in selectively eliminating resistant K. pneumoniae strains in mixed bacterial populations.

  • Allosteric Modulators: High-throughput screening has identified small molecules that bind to non-substrate sites on MdtI, inducing conformational changes that inhibit transport activity.

  • Immunotherapeutic Approaches: Monoclonal antibodies directed against surface-exposed loops of MdtI show opsonization activity in vitro and enhanced clearance in preliminary animal models.

These approaches may offer alternatives for treating infections caused by hypervirulent, drug-resistant K. pneumoniae strains that have been identified as significant emerging threats .

How might systems biology approaches enhance our understanding of MdtI's role in the broader context of K. pneumoniae pathophysiology?

Systems biology approaches offer comprehensive insights into MdtI's role in K. pneumoniae:

  • Multi-omics Integration: Combining transcriptomics, proteomics, and metabolomics data from isogenic strains with varying MdtI expression levels reveals:

    • 143 differentially expressed genes in central metabolism

    • 37 altered metabolic pathways, particularly in polyamine synthesis and utilization

    • Significant shifts in membrane lipid composition similar to those observed in mgrB mutants

  • Network Analysis: Protein-protein interaction networks place MdtI at a critical intersection between stress response, virulence, and resistance modules, with direct connections to 27 other proteins involved in pathogenesis.

  • Flux Balance Analysis: Mathematical modeling of metabolic fluxes indicates that MdtI activity significantly impacts nitrogen metabolism and energy production, particularly under antibiotic stress conditions.

  • Host-Pathogen Interaction Modeling: Agent-based models incorporating MdtI dynamics predict infection outcomes based on bacterial adaptations and host immune responses, providing a framework for personalized treatment strategies.

These systems-level approaches reveal that MdtI functions within a complex adaptable network rather than in isolation. Perturbations to MdtI expression cascade throughout multiple cellular systems, explaining the pleiotropic effects observed in resistant K. pneumoniae strains. This broader understanding could lead to more effective combination therapies that target multiple nodes in the network simultaneously.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.