Recombinant Klebsiella pneumoniae subsp. pneumoniae ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Klebsiella pneumoniae subsp. pneumoniae ATP Synthase Subunit a (atpB)

The recombinant ATP synthase subunit a (atpB) from Klebsiella pneumoniae subsp. pneumoniae is a critical component of the bacterial F-type ATP synthase complex. This enzyme catalyzes ATP synthesis via proton translocation across the inner membrane, a process essential for bacterial energy production and survival. The recombinant form is produced in E. coli with an N-terminal His tag for purification, enabling structural and functional studies of this medically relevant protein .

2.2. Role in ATP Synthase Complex

The atpB subunit forms part of the F0 sector, which facilitates proton translocation. This drives the rotation of the F1 sector, enabling ATP synthesis. Structural studies in related pathogens (e.g., Acinetobacter baumannii) highlight conserved features in a-subunits, including hydrophobic loops and charged residues critical for proton channeling .

3.1. Expression and Recombinant Design

  • Expression System: Produced in E. coli via plasmid-based expression.

  • Purification: Affinity chromatography via His tag, followed by lyophilization .

  • Reconstitution: Recommended in deionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

4.1. Transcriptional Regulation

The atpB-encoding operon is directly regulated by the two-component response regulator OmpR. Deletion of ompR results in:

  • 5x increase in atp operon transcription.

  • Overproduction of ATP due to enhanced F-type ATP synthase activity.

  • Reduction in mucoviscosity (linked to virulence) via altered energy metabolism .

Regulatory InteractionEffect
OmpR binding to atp promoterRepresses atp operon expression, stabilizing energy homeostasis
ΔompR mutationDisrupted mucoviscosity, increased ATP synthesis, reduced pathogenicity

4.2. Impact on Bacterial Virulence

Overexpression of the atp operon in K. pneumoniae:

  • Reduces mucoviscosity (a key virulence factor) by altering membrane physiology.

  • Compromises capsule stability, as shown in ompR-deficient strains .

5.1. Current Applications

  • Structural Elucidation: Cryo-EM studies of ATP synthase subunits in pathogens.

  • Vaccine Development: While not directly tested for atpB, ATP synthase subunits are explored as antigens in other pathogens .

  • Antimicrobial Targeting: Inhibiting proton translocation or ATP synthesis could disrupt bacterial energy production .

5.2. Emerging Research Areas

  1. Mechanistic Studies:

    • Role of atpB in proton channeling and rotation coupling.

    • Interactions with other F0 subunits (e.g., atpE, atpF).

  2. Therapeutic Potential:

    • Designing inhibitors targeting conserved a-subunit motifs (e.g., hydrophobic loops) .

  3. Pathogenesis Links:

    • Exploring how ATP synthase activity modulates antibiotic resistance or biofilm formation .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request as best as possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Important: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can serve as a reference for your reconstitution.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; KPN78578_41020; KPN_04143; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Target Names
atpB
Target Protein Sequence
MTPQDYIGHHLNNLQLDLRTFSLVDPHNHTATFWTLNIDSMFFSVVLGLLFLAMFRSVAK KATSGVPGKFQTFIEMIIGFVHGSVKDMYHGKSKVIAPLALTVFVWVFLMNLMDLLPIDL LPYIGEHIFGLPALRVVPSADVNITLSMALGVFILIIFYSIKMKGVGGFVKELTMQPFNH WAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWVLNVPWAIFH ILIITLQAFIFMVLTIVYLSMASEEH
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of atpB in the ATP synthase complex of K. pneumoniae?

The atpB gene encodes subunit a of the membrane-embedded F₀ portion of ATP synthase in K. pneumoniae. This subunit plays a critical role in proton translocation across the bacterial membrane and is essential for the rotary mechanism that drives ATP synthesis. The subunit forms part of the proton channel, with unique structural adaptations along both entry and exit pathways of the proton-conducting a-subunit . In bacterial ATP synthases, the complete complex has a subunit stoichiometry of α₃β₃γδεab₂c₁₀, with atpB encoding the a subunit that works in concert with other components to convert the proton motive force into chemical energy in the form of ATP .

How is the expression of ATP synthase regulated in K. pneumoniae?

The atp operon in K. pneumoniae is subject to complex regulatory control, with recent research highlighting the role of the two-component response regulator OmpR. Transcriptomic analyses have demonstrated that OmpR directly binds to the promoter region of the atp operon, serving as a negative regulator . Loss of OmpR function leads to overexpression of F-type ATP synthase, which alters the energetic status of bacterial cells . This regulatory mechanism appears to be linked to virulence phenotypes, as the ΔompR mutant exhibits reduced hypermucoviscosity and virulence in infection models .

What expression systems are most effective for producing recombinant K. pneumoniae atpB protein?

For recombinant expression of K. pneumoniae atpB, E. coli-based expression systems using pET vectors with T7 promoters have demonstrated good efficacy. When designing expression constructs, several considerations should be addressed:

Expression System ComponentRecommended OptionsConsiderations
Host strainE. coli C43(DE3) or C41(DE3)Specifically engineered for membrane protein expression
VectorpET-28a(+) with His-tagEnables IMAC purification; C-terminal tag often preferable
Induction conditions0.1-0.5 mM IPTG, 18-20°CLower temperatures reduce inclusion body formation
Expression enhancersPMSF, DNase I, lysozymeImproves cell lysis and initial purification

Methodologically, the protein should be expressed under conditions that minimize toxicity to the host, as membrane proteins like atpB can disrupt membrane integrity when overexpressed. Induction at lower temperatures (18-20°C) with reduced IPTG concentrations often improves the yield of properly folded protein.

What are the most effective methods for purifying recombinant atpB while maintaining its native conformation?

Purification of atpB presents challenges due to its highly hydrophobic nature as a membrane protein. A methodology similar to that used for A. baumannii ATP synthase can be adapted, involving:

  • Membrane isolation using ultracentrifugation (200,000 g for 30 min)

  • Solubilization with suitable detergents such as trans-4-(trans-4′-propylcyclohexyl)cyclohexyl-α-d-maltoside (tPCC-α-M) under gentle agitation

  • Affinity chromatography using streptavidin-tagged constructs

  • Ion exchange chromatography (MonoQ column) with gradual elution using KCl gradient

  • Size exclusion chromatography for final polishing

For functional studies, reconstitution into lipid nanodiscs or peptidiscs has proven effective for maintaining the native conformation of membrane proteins . This approach provides a more native-like environment than detergent micelles and improves the stability of the purified protein for structural and functional investigations.

What structural features of K. pneumoniae atpB are critical for its function in ATP synthesis?

The atpB-encoded subunit a contains several key structural elements essential for its function:

  • Transmembrane helices forming half-channels for proton translocation

  • Conserved arginine residue (typically Arg210 in bacterial homologs) that plays a crucial role in proton translocation

  • Interface regions that interact with the c-ring to form the functional proton path

These structural features create unique adaptations along both the entry and exit pathways of the proton-conducting mechanism. Unlike mitochondrial ATP synthases, bacterial ATP synthases like that of K. pneumoniae show distinct structural adaptations that could potentially serve as targets for antimicrobial development .

How can researchers effectively analyze the ATP hydrolytic activity of recombinant atpB in different experimental conditions?

To analyze ATP hydrolytic activity of recombinant atpB incorporated into the ATP synthase complex, researchers should consider employing the following methodological approach:

  • Reconstitution of purified protein into liposomes or nanodiscs to restore native-like membrane environment

  • Spectrophotometric assays coupling ATP hydrolysis to NADH oxidation via pyruvate kinase and lactate dehydrogenase enzymes

  • Analysis of activity across different pH values (6.0-8.0) and in presence of various divalent cations (Mg²⁺, Ca²⁺, Mn²⁺)

  • Inhibition studies using specific F₀F₁-ATP synthase inhibitors to confirm specificity of activity

When assessing autoinhibition mechanisms, researchers should note that bacterial ATP synthases often exhibit specific self-inhibition that supports unidirectional rotation mechanisms to prevent wasteful ATP consumption . These studies should be performed both in detergent-solubilized state and after reconstitution to accurately assess the functional properties of the protein.

How does atpB function contribute to K. pneumoniae virulence and pathogenicity?

The ATP synthase complex, including the atpB-encoded subunit a, plays a crucial role in bacterial energy metabolism that indirectly affects virulence. Recent research has established connections between energy metabolism and virulence phenotypes in K. pneumoniae:

  • The regulation of ATP synthase by OmpR affects hypermucoviscosity, a critical virulence factor for K. pneumoniae infections

  • Altered expression of ATP synthase components affects the energetic status of bacterial cells, influencing other virulence mechanisms

  • The loss of OmpR leads to overexpression of F-type ATP synthase, which correlates with reduced virulence in mouse pneumonia models

These findings suggest that proper regulation of ATP synthase is essential for maintaining the pathogenic potential of K. pneumoniae, potentially through effects on energy-dependent virulence factor production or secretion systems.

What is the relationship between ATP synthase function and antibiotic resistance in K. pneumoniae?

ATP synthase function has emerging connections to antibiotic resistance in K. pneumoniae through several mechanisms:

  • Energy-dependent efflux pumps require ATP for function, connecting ATP synthase activity to multidrug resistance

  • Membrane potential, maintained in part by ATP synthase, affects the uptake and efficacy of certain antibiotics

  • Regulatory networks that control ATP synthase expression overlap with those governing resistance mechanisms

For example, the transcription factor RamA regulates both ATP-binding cassette (ABC) transporters involved in antibiotic resistance and aspects of membrane stability . The mlaFEDCB operon, regulated by RamA, mediates resistance to tetracycline-class antibiotics, with knockout strains showing increased antibiotic sensitivity . These interconnections highlight the complex relationship between cellular energetics and antimicrobial resistance phenotypes in K. pneumoniae.

How can cryo-EM techniques be optimized for high-resolution structural analysis of K. pneumoniae ATP synthase containing atpB?

High-resolution structural analysis of K. pneumoniae ATP synthase can be approached using methodologies similar to those applied for related bacterial ATP synthases:

  • Sample preparation should include reconstitution into peptidiscs rather than detergent micelles to improve stability and structural integrity

  • Data collection should aim for >10,000 movies yielding >300,000 particles for multi-state analysis

  • Processing should employ multi-body refinement to account for the conformational heterogeneity between the F₁ and F₀ domains

  • Masked refinements should be used to improve local resolution in the membrane-embedded F₀ region, which typically shows poorer resolution (4-7 Å) in initial reconstructions

What approaches can be used to investigate the interactions between atpB and other subunits of the ATP synthase complex?

Methodological approaches to investigate subunit interactions within the ATP synthase complex include:

  • Cross-linking mass spectrometry (XL-MS): Using chemical crosslinkers followed by proteolytic digestion and mass spectrometry to identify interaction interfaces

  • FRET-based assays: Labeling specific residues to monitor distances between subunits and conformational changes during catalysis

  • Mutagenesis studies: Systematic mutation of residues at predicted interfaces to assess their impact on assembly and function

  • Co-immunoprecipitation with tagged subunits: Pulling down interacting partners to validate protein-protein interactions

These approaches can provide complementary information about how atpB interacts with other subunits, particularly the c-ring and other membrane components of the F₀ domain, as well as how these interactions change during the catalytic cycle.

What strategies can address low expression yields of recombinant K. pneumoniae atpB?

When faced with low expression yields of recombinant atpB, researchers should consider implementing the following methodological adjustments:

ChallengeTroubleshooting StrategyRationale
Toxicity to host cellsUse C43(DE3) strain with controlled inductionThese strains are adapted for toxic membrane proteins
Protein misfoldingLower induction temperature to 16-18°CSlows expression to allow proper membrane insertion
Poor solubilizationTest multiple detergents (DDM, LMNG, tPCC-α-M)Different detergents have varying efficacy for specific membrane proteins
Degradation during purificationAdd protease inhibitor cocktail; maintain low temperatureMinimizes proteolytic degradation during extraction
Inclusion body formationAdd 5-10% glycerol to expression mediaStabilizes membrane proteins during expression

Additionally, fusion tags such as MBP (maltose-binding protein) can improve solubility, though they may need to be removed for functional studies. Codon optimization for E. coli expression can also significantly improve yields when expressing K. pneumoniae proteins.

How can researchers overcome challenges in assessing the functional activity of recombinant atpB?

Functional characterization of recombinant atpB presents several challenges that can be addressed through methodological refinements:

  • Reconstitution efficiency: Optimize lipid composition and protein-to-lipid ratios for reconstitution; consider native K. pneumoniae lipid extracts for more physiologically relevant systems

  • Assay sensitivity: Employ coupled enzyme assays that amplify signal detection or luciferase-based ATP detection systems

  • Conformational heterogeneity: Use negative stain EM to assess sample quality and homogeneity before functional assays

  • Co-expression with partner subunits: Express atpB together with interacting subunits to promote proper folding and complex assembly

When encountering autoinhibited states of the enzyme , researchers should test various conditions to relieve inhibition, including different ion concentrations, pH values, and the presence of potential regulatory molecules that might reflect the in vivo environment of K. pneumoniae.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.