Recombinant Klebsiella pneumoniae subsp. pneumoniae Bifunctional protein aas (aas)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aas; KPN78578_31820; KPN_03245; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long-chain-fatty-acid--[acyl-carrier-protein] ligase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-719
Protein Length
full length protein
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Target Names
aas
Target Protein Sequence
MLLGFFRLLFKGLYRVRLTGDTQALYQQKVLITPNHVSFLDGILLALFLPVRPVFAVYTS ISQRWFMRALTPIIDFVPLDPTKPMSIKHLVRLIEQGRPVVIFPEGRISVSGSLMKIYDG AAFVAAKSQATIVPLRIEGAELTPFSRLKGLVKRRLFPRIQLHLLPPTHLPMPEAPRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLAAQDRFGARKPCVEDINFQPDTYRKLLTK TLFVARILEKYSQPGEKIGLMLPNAGISAAVIFGAIARGRIPAMMNYTAGVKGLSSAIAA AELNTIFTSRTFLDKGKLWHLPEQLTQVRWVFLEDLKGDITLADKLWIFAHLLAPRLAQV KQQPEDAAMILFTSGSEGNPKGVVHSHKSLLSNVEQIKTIADFTANDRFMSALPLFHSFG LTVGLLTPLLTGAEVFLYPSPLHYRVVPELVYDRNCTVLFGTSTFLANYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKVGTVGRILPGM DARLLAMPGIDQGGRLQLKGPNIMKGYLRVENPGVLEAPAAENQHGEMEAGWYDTGDIVT FDEQGYVRIQGRAKRFAKIAGEMISLEMVEQVALGASPDKMHATAIKQDASKGEALVLFT TDNELTREALLRYARQHGVPELAVPRDIRWLKQLPVLGSGKPDYVTLKNMVDEAETTHE
Uniprot No.

Target Background

Function

This bifunctional protein plays a crucial role in lysophospholipid acylation. It catalyzes the transfer of fatty acids to the 1-position of lysophospholipids via an enzyme-bound acyl-ACP intermediate, requiring ATP and magnesium. Its primary physiological function is the regeneration of phosphatidylethanolamine from 2-acyl-glycero-3-phosphoethanolamine (2-acyl-GPE), a byproduct of transacylation reactions or phospholipase A1 degradation.

Database Links
Protein Families
2-acyl-GPE acetyltransferase family; ATP-dependent AMP-binding enzyme family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Klebsiella pneumoniae Bifunctional protein aas?

Klebsiella pneumoniae Bifunctional protein aas is a multifunctional enzyme encoded by the aas gene in Klebsiella pneumoniae bacteria. The protein is classified as "bifunctional" due to its dual enzymatic activities, which include 2-acylglycerophosphoethanolamine acyltransferase (EC= 2.3.1.40) functionality . This enzyme plays a critical role in bacterial membrane phospholipid metabolism and maintenance. The full-length protein consists of 719 amino acids and has been successfully expressed as a recombinant protein in E. coli expression systems with various tags (such as His-tag) to facilitate purification and downstream research applications .

What are the optimal storage and handling conditions for recombinant aas protein?

For maintaining optimal stability and activity of recombinant Klebsiella pneumoniae Bifunctional protein aas, the following storage and handling protocols are recommended:

Storage ParameterRecommended Condition
Long-term storage-20°C/-80°C
Working storage4°C (up to one week)
Physical formLyophilized powder
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Stability additive5-50% glycerol (final concentration)
Special considerationsAliquoting necessary for multiple use; avoid repeated freeze-thaw cycles

When handling the reconstituted protein, it is recommended to briefly centrifuge the vial prior to opening to bring contents to the bottom . For long-term storage after reconstitution, adding glycerol (typically to a final concentration of 50%) and aliquoting the sample can help preserve protein integrity and enzymatic activity .

What functional domains and mechanisms characterize the Bifunctional protein aas?

The Klebsiella pneumoniae Bifunctional protein aas contains at least two distinct functional domains that contribute to its enzymatic versatility:

  • 2-acylglycerophosphoethanolamine acyltransferase domain (EC= 2.3.1.40): This domain catalyzes the transfer of acyl groups to glycerophosphoethanolamine substrates, playing a crucial role in phospholipid remodeling .

  • Acyl-[acyl-carrier-protein]--phospholipid domain: This functionality suggests the protein's involvement in transferring acyl groups from acyl-carrier proteins to phospholipids, contributing to membrane lipid biosynthesis and turnover .

The bifunctional nature of this protein enables it to coordinate multiple aspects of bacterial membrane phospholipid metabolism within a single polypeptide chain. This arrangement likely facilitates efficient coupling between different steps in phospholipid biosynthesis and remodeling pathways, providing Klebsiella pneumoniae with adaptive mechanisms for maintaining membrane integrity under varying environmental conditions.

Sequence analysis indicates the presence of motifs characteristic of acyltransferases, including potential substrate binding pockets and catalytic residues. The protein's sequence suggests it may have membrane-associated regions, consistent with its role in phospholipid metabolism.

What methodologies can be employed to measure aas protein enzymatic activity in vitro?

To effectively measure the enzymatic activities of Klebsiella pneumoniae Bifunctional protein aas in vitro, researchers can implement several complementary approaches:

Assay TypeMethodologyDetectionAdvantages
SpectrophotometricUsing DTNB (Ellman's reagent) to detect free CoA releaseAbsorbance at 412 nmReal-time monitoring, quantitative
Radiometric14C-labeled acyl-CoA incorporation into phospholipidsScintillation counting after TLC separationHigh sensitivity, direct measurement of product formation
ChromatographicHPLC or LC-MS analysis of substrate consumption and product formationUV, MS, or ELSD detectionHigh resolution, identification of multiple products
Fluorescence-basedFluorescently labeled substrates or coupled enzyme reactionsFluorescence emissionHigh sensitivity, potential for high-throughput screening

A typical reaction buffer composition for acyltransferase activity measurement would include:

  • 50 mM Tris-HCl or HEPES buffer, pH 7.5-8.0

  • 100-150 mM NaCl

  • 5-10 mM MgCl2 (as a cofactor)

  • 0.1-1 mM DTT (to maintain reducing conditions)

  • 0.05-0.1% detergent (for membrane-associated enzyme)

  • Appropriate substrates: acyl-CoA donors and phospholipid acceptors

When establishing an activity assay, researchers should:

  • Determine the linear range of the assay with respect to enzyme concentration and time

  • Generate a calibration curve with known product concentrations

  • Include appropriate controls (heat-inactivated enzyme, no-substrate controls)

  • Calculate specific activity in terms of μmol product formed per minute per mg of protein

This methodological framework provides a robust foundation for characterizing the enzymatic properties of the aas protein, including substrate specificity, kinetic parameters, and the effects of potential inhibitors.

What challenges exist in expressing and purifying recombinant Klebsiella pneumoniae aas protein?

Expression and purification of recombinant Klebsiella pneumoniae Bifunctional protein aas presents several technical challenges that researchers should consider when designing experimental protocols:

Expression Challenges:

ChallengeDescriptionPotential Solutions
Membrane associationProtein sequence suggests membrane-interacting regionsUse specialized expression strains; include detergents in lysis buffer
Size complexity719 amino acid length increases susceptibility to premature terminationOptimize codon usage; lower expression temperature (16-20°C)
Potential toxicityMembrane protein overexpression may disrupt host cell membranesUse tightly regulated expression systems; reduce induction levels
Proper foldingMulti-domain protein requires coordinated foldingCo-express with chaperones; include folding enhancers
Solubility limitationsHydrophobic regions may cause aggregationFusion tags (SUMO, MBP, GST); solubility-enhancing additives

Purification Challenges:

The recombinant protein is typically expressed with a His-tag to facilitate purification , but additional considerations include:

  • Optimization of lysis conditions: Inclusion of appropriate detergents to solubilize membrane-associated protein while maintaining activity

  • Multi-step purification strategy: Combining affinity chromatography (IMAC) with ion exchange and/or size exclusion chromatography

  • Activity preservation: Identifying buffer components that maintain structural integrity and prevent aggregation

  • Purity assessment: Achieving >90% purity as determined by SDS-PAGE

  • Removal of contaminating bacterial lipids: Additional wash steps or specialized chromatography

Current successful expression strategies utilize E. coli as the expression host with His-tagged constructs , which provides a starting point for further optimization based on specific research requirements.

How can site-directed mutagenesis be utilized to investigate the active sites of aas protein?

Site-directed mutagenesis represents a powerful approach for dissecting the structure-function relationships of the Klebsiella pneumoniae Bifunctional protein aas, particularly for elucidating the roles of specific residues in catalysis and substrate binding:

Systematic Mutagenesis Strategy:

  • Target residue identification:

    • Computational prediction of catalytic residues through sequence alignment with characterized homologs

    • Identification of conserved motifs typical for acyltransferases

    • Structure-based prediction of substrate-binding residues

  • Mutagenesis approaches:

ApproachDescriptionApplication
Alanine scanningSystematic replacement with alanineIdentify essential residues
Conservative substitutionsReplace with similar amino acids (e.g., Asp→Glu)Probe specific chemical requirements
Non-conservative substitutionsDramatic changes in residue propertiesTest hypotheses about residue function
Domain swappingCreate chimeric proteins with homologous domainsInvestigate domain-specific functions
  • Experimental workflow:

    • Design of PCR-based mutagenesis protocols

    • Expression and purification of mutant proteins using established protocols

    • Parallel characterization of wild-type and mutant proteins

  • Functional analysis of mutants:

    • Enzyme activity assays to determine effects on catalytic parameters (kcat, Km)

    • Substrate binding studies to assess changes in binding affinity

    • Thermal stability analysis to detect structural perturbations

    • Structural studies (if feasible) to observe conformational changes

  • Data interpretation and modeling:

    • Structure-function correlation analysis

    • Development of mechanistic models for enzymatic action

    • Identification of potential targets for inhibitor design

This systematic approach can provide detailed insights into the catalytic mechanism of aas protein and potentially reveal strategies for targeted inhibition, which may have relevance for antimicrobial development against Klebsiella pneumoniae.

How can research literature contradiction detection be applied to resolve conflicting findings about aas protein?

In the evolving field of research on Klebsiella pneumoniae Bifunctional protein aas, contradictory findings may emerge due to methodological differences, strain variations, or interpretation discrepancies. Modern contradiction detection approaches can help researchers navigate and resolve these conflicts:

Systematic Contradiction Analysis Framework:

  • Literature mining and contradiction identification:

    • Application of natural language processing (NLP) and deep learning models trained on contradiction detection

    • Automated extraction of statements about aas protein from scientific literature

    • Identification of potentially contradictory claims regarding structure, function, or regulation

  • Categorization of contradictions:

  • Implementation of contradiction detection systems:

    • Development of domain-specific models for protein biochemistry

    • Fine-tuning existing models using distant supervision with ontology-driven datasets

    • Creation of databases documenting resolved and unresolved contradictions

Recent advances in clinical contradiction detection using distant supervision over clinical ontologies have demonstrated statistically significant improvements in identifying contradictions in medical literature . These approaches can be adapted to the biochemical research domain, particularly for bacterial proteins like aas.

A systematic approach to contradiction detection can help researchers:

  • Identify knowledge gaps requiring further investigation

  • Prioritize research questions with the greatest uncertainty

  • Design definitive experiments to resolve contradictory findings

  • Build consensus models that integrate diverse experimental data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.