Recombinant Klebsiella pneumoniae subsp. pneumoniae Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
clsA; cls; KPN78578_21570; KPN_02190; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Target Names
clsA
Target Protein Sequence
MTTFYTVVNWLVILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSFGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAEDNSPVAESLFKLCERRQGIGGVKGNQ LQLLTESDDVMQALIRDIQLARHNIEMVFYIWQPGGMADSVAESLMAAARRGVHCRLMLD SAGSVAFFRSPWAAMMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMVMIDNYIAYTGSM NMVDPRYFKQDSGVGQWIDLMARMEGPVATSMGIVYSCDWEIETGKRILPPPPDVNIMPF EEASGHTIHTIASGPGFPEDLIHQALLTAAYAAKEHLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSLLVGWASRAFFTELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLVIDDAGFGSDLAAVQDDYISRSRLLDARLWLKRPLWQRIAERLFY FFSPLL
Uniprot No.

Target Background

Function
Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL) (diphosphatidylglycerol) and glycerol.
Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cardiolipin synthase (cls) from Klebsiella pneumoniae?

Cardiolipin synthase (cls) from Klebsiella pneumoniae is an enzyme that catalyzes the final step in cardiolipin biosynthesis. This enzyme transfers a phosphatidyl residue from CDP-diacylglycerol (CDP-DAG) to phosphatidylglycerol (PG), resulting in the formation of cardiolipin, a unique phospholipid essential for bacterial membrane stability and function . The full-length protein consists of 486 amino acids and contains multiple transmembrane domains characteristic of membrane-associated enzymes . Notably, the amino acid sequence of Klebsiella pneumoniae cls reflects its bacterial origin, with the catalytic mechanism differing significantly from eukaryotic cardiolipin synthases .

How does Klebsiella pneumoniae cls differ from eukaryotic cardiolipin synthases?

Klebsiella pneumoniae cardiolipin synthase represents a bacterial-type enzyme that mechanistically differs from eukaryotic counterparts in several key aspects:

  • Catalytic mechanism: Bacterial cls transfers a phosphatidyl group from CDP-DAG to PG, while eukaryotic cls typically catalyzes the condensation of two PG molecules .

  • Sequence motifs: The catalytic sites contain different conserved motifs, reflecting their divergent evolutionary origins .

  • Substrate specificity: Bacterial cls shows distinct substrate preferences compared to eukaryotic enzymes .

  • Structural organization: Bacterial cls contains multiple transmembrane domains and belongs to the phospholipase D superfamily, with two conserved HKD motifs that contribute to the catalytic activity .

This distinction is important for researchers designing inhibitors or studying evolutionary relationships, as exemplified by the discovery of a bacterial-type cardiolipin synthase in Trypanosoma brucei, suggesting that trypanosomatids may be among the most ancient living eukaryotes .

What is the role of cardiolipin in bacterial physiology?

Cardiolipin plays several critical roles in bacterial physiology, particularly in Klebsiella pneumoniae:

  • Membrane stability: Cardiolipin contributes to the structural integrity of bacterial membranes, especially under stress conditions .

  • Virulence factor regulation: Research has shown that cardiolipin modulates the kinase activity of bacterial two-component systems after infection, helping bacteria adapt to the hostile environment of the host .

  • Growth phase adaptation: Cardiolipin levels increase toward stationary growth phase, suggesting a role in adapting to nutrient limitation .

  • Resistance to host defense: Deletion of cardiolipin synthase genes (cls1 and cls2) in Staphylococcus aureus leads to reduced cytotoxicity to human neutrophils and lower virulence in mouse infection models .

  • Antibiotic resistance: Mutations in cls have been associated with daptomycin resistance in enterococci, indicating its importance in membrane-targeting antibiotic susceptibility .

What expression systems are optimal for producing recombinant Klebsiella pneumoniae cls?

The optimal expression system for producing recombinant Klebsiella pneumoniae cls depends on research objectives, with several viable options:

  • E. coli expression system: Most commonly used for recombinant Klebsiella pneumoniae cls, offering high yield and simplicity. The enzyme is typically fused to an N-terminal His-tag to facilitate purification . This system is particularly suitable for biochemical characterization and structural studies.

  • Yeast expression systems: Useful when post-translational modifications or eukaryotic chaperones might improve protein folding, though less commonly reported for bacterial cls .

  • Baculovirus expression: Preferred when studying membrane protein interactions or when E. coli-expressed protein shows limited activity .

When selecting an expression system, researchers should consider:

  • The full-length cls protein (486 amino acids) contains multiple transmembrane domains, making proper folding and membrane insertion critical for activity

  • Co-expression with chaperones may improve yield of functionally active enzyme

  • Expression temperature, induction conditions, and detergent selection significantly impact final yield and activity

What are the established protocols for measuring Klebsiella pneumoniae cls enzyme activity?

Cardiolipin synthase activity from Klebsiella pneumoniae can be assayed using several established protocols:

1. In vitro enzyme assay with radiolabeled substrates:

  • Reaction mixture typically contains:

    • 50 mM Tris/HCl (pH 8.0)

    • 4.0 mM MgCl₂

    • 20 μM [¹⁴C]oleoyl-CoA (50 mCi/mmol)

    • 2.0 mM LPG {1-oleoyl-2-hydroxy-sn-glycero-3-[phospho-rac-(1-glycerol)]}

    • 2.0 mM CDP-DAG

  • The reaction is initiated by adding 50 μg of cell homogenates containing recombinant cls

  • Incubation: 20 minutes at 30°C

  • Reaction termination: Add 1 ml of chloroform/methanol (2:1, v/v), followed by 0.4 ml of 0.9% KCl

  • Analysis: TLC separation using chloroform/methanol/water (65:25:4, by vol.) as the developing solvent

2. Alternative two-step assay with LPGAT1:

  • First reaction: Generate [¹⁴C]PG using LPGAT1 (lysophosphatidylglycerol acyltransferase)

  • Second reaction: Use [¹⁴C]PG and CDP-DAG as substrates for cls

  • Product detection: Visualization by phosphoimager and quantification by ImageQuant

3. In vivo complementation assay:

  • Transform cls-deficient bacteria with plasmids expressing Klebsiella pneumoniae cls

  • Grow transformants to stationary phase in appropriate media

  • Extract total lipids and analyze cardiolipin content by TLC and mass spectrometry

4. Whole-cell labeling approach:

  • Transfect cells with cls expression plasmid

  • Culture in the presence of [¹⁴C]oleoyl-CoA to label newly synthesized lipids

  • Extract total lipids and analyze cardiolipin production

How does cardiolipin synthase contribute to Klebsiella pneumoniae virulence?

Cardiolipin synthase contributes to Klebsiella pneumoniae virulence through several mechanisms:

  • Membrane integrity: Cardiolipin stabilizes bacterial membranes, especially under stress conditions encountered during infection, such as pH changes, osmotic stress, and exposure to host antimicrobial peptides .

  • Hypermucoviscosity: While direct evidence specifically for Klebsiella pneumoniae cls is limited, research on related bacteria suggests that altered membrane phospholipid composition affects capsule production and hypermucoviscosity, a key virulence trait. In Klebsiella pneumoniae isolates, hypermucoviscosity is detected in 44% of clinical samples and correlates with increased pathogenicity .

  • Environmental adaptation: Cardiolipin synthesis increases under specific stress conditions, helping bacteria survive the hostile host environment .

  • Biofilm formation: Cardiolipin likely influences biofilm formation, which is observed in 54% of clinical Klebsiella pneumoniae isolates and contributes to antibiotic resistance and persistence .

  • Host immune evasion: In related bacteria, cardiolipin synthesis affects susceptibility to host immune mechanisms. Deletion of cls genes can reduce cytotoxicity to human neutrophils .

  • Mitochondrial disruption: During infection, bacterial cardiolipin may interfere with host cell mitochondrial function, potentially contributing to pathogenesis .

What is the relationship between cardiolipin synthase and antibiotic resistance in Klebsiella pneumoniae?

The relationship between cardiolipin synthase and antibiotic resistance in Klebsiella pneumoniae is an emerging area of research:

  • Membrane permeability: Cardiolipin alters membrane fluidity and permeability, potentially affecting the entry of antibiotics into bacterial cells .

  • Membrane-targeting antibiotics: Modifications in cardiolipin synthesis can particularly affect susceptibility to membrane-targeting antibiotics. In related bacteria, mutations in cls have been associated with daptomycin resistance .

  • Colistin resistance: Recent findings have identified colistin-resistant Klebsiella pneumoniae strains (carrying mcr-8.1) that exhibit altered membrane composition, though the direct relationship with cardiolipin synthase in these strains requires further investigation .

  • Multi-drug resistant (MDR) strains: Emerging MDR-hypervirulent Klebsiella pneumoniae strains show altered virulence and membrane characteristics that may involve changes in cardiolipin synthesis or composition .

  • Extended-spectrum β-lactamase (ESBL) production: While direct evidence linking cardiolipin synthase to ESBL production is limited, the membrane modifications associated with altered cardiolipin synthesis may work synergistically with β-lactamases to enhance resistance .

  • Biofilm-associated resistance: Cardiolipin's role in membrane organization likely influences biofilm formation, which provides resistance to multiple antibiotics .

How can site-directed mutagenesis of Klebsiella pneumoniae cls inform structure-function relationships?

Site-directed mutagenesis of Klebsiella pneumoniae cardiolipin synthase provides valuable insights into structure-function relationships:

  • Catalytic domains: Mutations in the conserved HKD motifs can help identify essential residues for catalysis. Based on homology to phospholipase D, His217 is likely a key active-site nucleophile .

  • Functional regions: From research on related bacterial cls proteins, three critical regions have been identified that could guide mutagenesis studies :

    • N-terminal transmembrane helical region

    • Short linker region joining N-terminal transmembrane helices to the catalytic PLD domains

    • Regions proximal to the PLD1 catalytic site

  • Substrate specificity: Mutagenesis of residues in the predicted substrate-binding pocket can help determine the molecular basis for CDP-DAG and PG recognition.

  • Membrane association: Mutations in transmembrane domains can elucidate how membrane anchoring affects enzyme activity.

  • Regulatory mechanisms: Investigation of potential phosphorylation sites or protein-protein interaction domains through mutagenesis may reveal how cls activity is regulated in vivo.

When designing mutagenesis experiments, researchers should consider:

  • Creating alanine scanning mutants across conserved regions

  • Generating chimeric proteins with other bacterial cls enzymes to identify specificity determinants

  • Using complementation of cls-deficient bacteria to assess mutant functionality in vivo

What comparative genomics approaches reveal insights about cls evolution and function?

Comparative genomics approaches have revealed several important insights about cardiolipin synthase evolution and function:

  • Evolutionary divergence: Bacterial cls enzymes, including that from Klebsiella pneumoniae, differ mechanistically from eukaryotic cardiolipin synthases, using distinct catalytic mechanisms and substrate preferences .

  • Ancient eukaryotic origins: The discovery of bacterial-type cardiolipin synthase in Trypanosoma brucei suggests that some eukaryotic lineages may have retained the bacterial-type enzyme through evolution, supporting the hypothesis that trypanosomatids are among the most ancient living eukaryotes .

  • Multiple cls isoforms: In some bacteria, multiple cls genes (clsA, clsB, clsC) have been identified, each with specific functional roles. For example, in E. coli:

    • ClsA and ClsB are the main enzymes for cardiolipin synthesis

    • ClsC requires co-expression with the neighboring gene ymdB for optimal activity

  • Genomic context: Analysis of cls gene neighborhoods across bacterial species can identify potential functional partners or regulatory elements.

  • Horizontal gene transfer: Comparative genomics may identify instances of cls genes being transferred between bacterial species, potentially conferring new virulence traits.

  • Klebsiella pneumoniae genomic surveillance: The Kleborate tool provides a framework for analyzing Klebsiella pneumoniae genomes, including virulence factors and antimicrobial resistance markers, which could be extended to include cls variation analysis .

What are the challenges in expressing and purifying functional recombinant Klebsiella pneumoniae cls?

Researchers face several challenges when expressing and purifying functional recombinant Klebsiella pneumoniae cardiolipin synthase:

  • Membrane protein solubility: As a membrane-associated enzyme with multiple transmembrane domains, cls is inherently difficult to express in soluble, active form .

  • Detergent selection: Identifying appropriate detergents that maintain enzyme structure while extracting it from membranes is critical. Commonly used detergents include:

    • n-Dodecyl β-D-maltoside (DDM)

    • Digitonin

    • CHAPS

  • Lipid requirements: The enzyme likely requires specific lipids for optimal activity, necessitating careful consideration of lipid composition during purification and assays.

  • Expression toxicity: Overexpression of membrane proteins often causes toxicity to host cells, requiring optimization of expression conditions (temperature, inducer concentration, expression duration).

  • Proper folding: Ensuring correct folding and membrane insertion during expression is essential for obtaining functionally active enzyme.

  • Co-expression requirements: As seen with ClsC from E. coli, some cardiolipin synthases may require co-expression with partner proteins for optimal activity .

  • Post-purification stability: Maintaining enzyme stability after purification requires careful buffer optimization, including:

    • pH optimization (typically around pH 8.0)

    • Glycerol addition (often 50% for storage)

    • Appropriate salt concentration

    • Consideration of stabilizing lipids or additives

What is the role of cardiolipin in Klebsiella pneumoniae infection and host response?

Recent research has revealed several important aspects of cardiolipin's role in Klebsiella pneumoniae infection and host response:

  • Infection establishment: Cardiolipin contributes to membrane stability under the stressful conditions encountered during infection, helping Klebsiella pneumoniae establish and maintain infection .

  • Immune evasion: Cardiolipin may help Klebsiella pneumoniae evade host immune responses. Studies in related bacteria show that deletion of cls genes reduces cytotoxicity to human neutrophils .

  • Virulence factor regulation: Cardiolipin modulates the kinase activity of bacterial two-component systems after infection, helping bacteria adapt to the hostile host environment .

  • Hospital-acquired infections: Klebsiella pneumoniae is a major cause of hospital-acquired infections, with cardiolipin potentially contributing to its survival in healthcare settings .

  • Specific clinical manifestations: Klebsiella pneumoniae causes various infections including:

    • Urinary tract infections (UTIs)

    • Pneumonia

    • Meningitis

    • Bloodstream infections

    • Wound infections

    • Liver abscesses

    Distribution of clinical isolates shows predominance in pus samples (34%), endotracheal tube samples (28.67%), and sputum (14.66%) .

  • Host susceptibility: While healthy individuals rarely develop Klebsiella pneumoniae infections, those with underlying health conditions are at higher risk, including people with:

    • Alcoholism

    • Cancer

    • Diabetes

    • Kidney failure

    • Liver or lung disease

What novel experimental approaches are being developed to study cardiolipin synthase function?

Researchers are developing several innovative approaches to study cardiolipin synthase function:

  • Genomic surveillance frameworks: Tools like Kleborate provide integrated analysis of Klebsiella pneumoniae genomes, which could be extended to include cls variation and its relationship to virulence and resistance .

  • Transposon mutagenesis screens: High-throughput screening of transposon libraries in Klebsiella pneumoniae can identify fitness genes essential for growth in different conditions, potentially highlighting new roles for cls .

  • Metagenome analysis: Techniques for detecting and typing Klebsiella pneumoniae from gut metagenomes could reveal the role of cls in colonization and commensalism .

  • In vivo imaging techniques: Fluorescently tagged cardiolipin-binding proteins or probes can visualize cardiolipin distribution in living bacteria during infection.

  • Bacterial two-component system regulation studies: Investigation of how cardiolipin modulates kinase activity of sensor kinases provides insight into bacterial adaptation mechanisms .

  • CRISPR-Cas9 genome editing: Precise modification of the cls gene in Klebsiella pneumoniae can create targeted mutations for functional studies.

  • Protein-lipid interaction analysis: Advanced techniques like hydrogen-deuterium exchange mass spectrometry (HDX-MS) can reveal how cardiolipin synthase interacts with membrane lipids.

What are the correlations between cardiolipin synthase activity and expression of virulence factors in Klebsiella pneumoniae?

The correlations between cardiolipin synthase activity and virulence factor expression in Klebsiella pneumoniae are beginning to emerge from research:

  • Virulence factor distribution: Clinical isolates of Klebsiella pneumoniae express multiple virulence factors, with varying prevalence :

Virulence FactorPrevalence in K. pneumoniae isolates
Capsule100.0%
Hypermucoviscosity (HMV)44.0%
Biofilm Formation54.0%
Siderophore Production73.33%
Protease90.0%
Gelatinase84.0%
Lipase79.33%
Lecithinase Activity54.66%
Hemolysis4.66%
  • Membrane remodeling effects: Changes in cardiolipin composition likely affect membrane properties that influence the expression and function of membrane-associated virulence factors .

  • Two-component system regulation: In related bacteria, cardiolipin modulates the kinase activity of two-component systems like SaeS, which regulates virulence gene expression .

  • Growth phase-dependent regulation: Both cardiolipin synthesis and virulence factor expression increase toward stationary phase, suggesting coordinated regulation .

  • Stress response connection: Environmental stressors that induce cardiolipin synthesis may also trigger virulence factor expression .

  • Hypervirulent strains: Recent research has identified emergence of multidrug-resistant hypervirulent Klebsiella pneumoniae strains carrying both antimicrobial resistance genes and hypervirulence-associated genes like aerobactin siderophore clusters (iucABCD-iutA) and the hypermucoidy locus rmpADC . The relationship between cardiolipin synthesis and these hypervirulence traits remains to be fully elucidated.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.