Recombinant Klebsiella pneumoniae subsp. pneumoniae Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. To prioritize a specific tag, please inform us in advance.
Synonyms
frdC; KPN78578_44810; KPN_04551; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Target Names
frdC
Target Protein Sequence
MTTKRKPYVRPMTSTWWKKLPFYRFYMVREGTAVPTVWFSIVLIYGLFALKHGADSWAGY IGFLQNPVVVILNLITLAAALLHTKTWFELAPKAANVIIKGEKMGPEPVIKGLWVVTAVV TVVILFVALFW
Uniprot No.

Target Background

Function
Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate: fumarate reductase (used in anaerobic growth) and succinate dehydrogenase (used in aerobic growth). Fumarate reductase subunit C anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.
Database Links
Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of fumarate reductase in Klebsiella pneumoniae metabolism?

The enzyme consists of multiple subunits, with frdC serving as the membrane anchor subunit that contains heme groups essential for electron transfer. While primarily associated with anaerobic growth, research has shown that fumarate reductase can also operate in reverse as a succinate dehydrogenase during aerobic conditions in some bacterial species, highlighting its metabolic versatility .

How does frdC differ structurally and functionally from other fumarate reductase subunits?

The fumarate reductase complex typically consists of four subunits: frdA (flavoprotein), frdB (iron-sulfur protein), and the membrane anchor subunits frdC and frdD. The frdC subunit specifically:

  • Contains heme b groups that facilitate electron transfer across the membrane

  • Serves as an integral membrane protein anchoring the complex to the cytoplasmic membrane

  • Possesses transmembrane helices that help maintain the structural integrity of the enzyme complex

Unlike the catalytic subunits (frdA and frdB), frdC does not directly participate in the reduction of fumarate to succinate but is essential for proper electron transport chain functioning. Structural studies have shown that frdC interacts with both the catalytic components and the quinone pool within the membrane, making it crucial for coupling electron transport to energy conservation .

What experimental evidence supports the role of frdC in K. pneumoniae virulence?

Studies examining the role of fumarate reductase in K. pneumoniae virulence have shown mixed results, with evidence suggesting context-dependent contributions:

Study ApproachKey FindingsImplications for frdC
In vivo colonization modelsfrdA mutants showed significantly reduced colonization capabilitySuggests the entire frd complex (including frdC) is important for host colonization
Aerotolerance assaysDeletion of frdC increased survival under oxidative stress conditionsIndicates frdC contributes to ROS generation during oxygen exposure
Transcriptomic analysesfrd operon upregulation during host infectionSupports role in adaptation to host environments

Comparative studies with other bacterial pathogens like Campylobacter jejuni have demonstrated that the frdA mutant strain colonized hosts at significantly lower levels than wild-type strains, while mutation of other oxidative enzymes had less impact . Similar observations in K. pneumoniae suggest that the intact frd complex, including frdC, plays an important role in bacterial adaptation to the host environment .

What are the best approaches for generating recombinant K. pneumoniae frdC constructs?

Generating recombinant K. pneumoniae frdC constructs requires careful design considerations due to the membrane-associated nature of the protein. The following methodological approaches have proven effective:

PCR-based cloning approach:

  • Design primers with appropriate restriction sites flanking the frdC gene from K. pneumoniae genomic DNA

  • Amplify the gene using high-fidelity polymerase

  • Clone into an expression vector with an inducible promoter (e.g., pET28a with T7 promoter)

  • Include an affinity tag (His-tag or FLAG) for purification purposes

  • Transform into an appropriate E. coli expression strain (BL21(DE3) or derivatives)

Lambda Red recombineering approach for chromosomal manipulation:
The λ Red recombinase system has been successfully used for constructing isogenic mutants in K. pneumoniae:

  • Amplify antibiotic resistance cassette flanked by 50-100bp homology regions to the target frdC gene

  • Transform the PCR product into K. pneumoniae expressing the λ Red recombination proteins

  • Select for recombinants on appropriate antibiotic media

  • Confirm the knockout via colony PCR using primers that flank the insertion site

  • For unmarked mutations, use FLP recombinase to remove the resistance marker

For optimal expression, consider using K. pneumoniae-specific promoters when expressing in the native host, as heterologous promoters may function differently .

What challenges are associated with purifying recombinant frdC protein and how can they be addressed?

Purifying recombinant frdC protein presents several challenges due to its intrinsic membrane properties:

ChallengeSolution ApproachTechnical Details
Membrane localizationOptimize detergent extractionUse mild detergents like DDM (0.5-1%) or LDAO (0.05-0.1%) for solubilization
Protein stabilityInclude stabilizing agentsAdd glycerol (10-20%), reducing agents (5mM β-mercaptoethanol) to buffers
Low expression levelsOptimize expression conditionsTest different induction temperatures (16-30°C), inducer concentrations, and expression durations
Proper foldingCo-expression with chaperonesInclude plasmids expressing GroEL/ES or DnaK/J/GrpE chaperone systems
Heme incorporationSupplement growth mediaAdd δ-aminolevulinic acid (0.1-0.5mM) to promote heme synthesis

When purifying the entire fumarate reductase complex, consider using milder purification approaches and native-PAGE analysis to maintain subunit interactions. For functional studies, reconstitution into proteoliposomes may be necessary to preserve enzymatic activity. When purifying just frdC, specialized amphipathic polymers like SMALPs (Styrene Maleic Acid Lipid Particles) have shown promise for maintaining membrane protein integrity during purification .

How can I design experiments to evaluate the contribution of frdC to ROS generation in K. pneumoniae?

To evaluate the contribution of frdC to ROS generation in K. pneumoniae, consider the following experimental design:

Construction of deletion mutants:

  • Generate a clean frdC deletion mutant using λ Red recombineering or CRISPR-Cas9 technology

  • Create a complemented strain by reintroducing frdC on a plasmid under native or inducible promoter

  • Generate relevant control strains (e.g., deletion of other ROS-scavenging enzymes)

ROS detection assays:

H2O2DetectionProtocolH₂O₂ Detection Protocol

  • Grow strains to mid-log phase in appropriate media

  • Add H₂O₂ to a starting concentration of 2.5-5 μM

  • Collect samples at regular intervals

  • Measure peroxide levels using Amplex Red with horseradish peroxidase

  • Compare H₂O₂ scavenging rates between wild-type, ΔfrdC, and complemented strains

Aerotolerance testing:

  • Grow strains anaerobically to equivalent optical densities

  • Expose cultures to ambient oxygen for varying time periods

  • Determine survival by plating for viable counts

  • Compare survival rates between wild-type and mutant strains

How does recombinant expression of frdC affect the assembly of the entire fumarate reductase complex?

The assembly of the entire fumarate reductase complex in K. pneumoniae is a coordinated process affected by stoichiometric expression of its components. When frdC is recombinantly expressed:

  • Stoichiometric Imbalance Effects:

    • Overexpression of frdC alone typically results in incomplete complex formation

    • The membrane integration of excess frdC may disrupt membrane integrity

    • Unpartnered frdC is often rapidly degraded by proteolytic systems

  • Complete Complex Formation Requirements:

    • Co-expression of all four subunits (frdABCD) is generally required for proper complex assembly

    • The order of assembly appears to be hierarchical, with the catalytic subunits assembling first

    • Proper heme incorporation into frdC is essential for stable complex formation

  • Experimental Evidence from Related Systems:
    When studying C. jejuni, researchers found that the frdA::cat+ strain was completely deficient in succinate dehydrogenase activity both in vitro and in vivo, indicating the essential nature of the complete complex .

The most effective approach for functional studies involves using polycistronic expression constructs that maintain the natural gene organization and relative expression levels. For structural studies, co-expression systems with differentially tagged subunits allow monitoring of complex assembly efficiency .

What role does frdC play in K. pneumoniae adaptation to different oxygen environments?

Fumarate reductase subunit C plays a crucial role in K. pneumoniae adaptation to varying oxygen environments, functioning as a metabolic switch that helps the bacterium transition between aerobic and anaerobic metabolism:

Oxygen ConditionfrdC FunctionMetabolic Impact
AnaerobicEssential component of fumarate reductaseEnables anaerobic respiration using fumarate as terminal electron acceptor
MicroaerobicActs in dual capacityFacilitates flexible metabolism in oxygen-limited environments
AerobicPotential contributor to ROS generationMay increase oxidative stress during aerobic growth

Studies in related bacteria have shown that fumarate reductase is a major contributor to ROS formation when exposed to oxygen. For example, deletion of frdC increased the aerotolerance of a Bacteroides fragilis strain lacking superoxide dismutase . In K. pneumoniae, the ability to rapidly adapt between aerobic and anaerobic metabolism is crucial for successful colonization of diverse host environments, including the intestinal tract and lungs.

Furthermore, transcriptomic studies have shown differential expression of the frd operon in response to oxygen availability, with upregulation under anaerobic conditions and during host infection. This adaptive response allows K. pneumoniae to optimize its energy metabolism according to environmental conditions .

How do genomic recombination events affect frdC expression and function across different K. pneumoniae strains?

Genomic recombination events have significant impacts on frdC expression and function across K. pneumoniae strains, contributing to metabolic diversity and adaptive potential:

  • Sequence Variation Analysis:
    Studies analyzing 22,600 K. pneumoniae genomes have revealed that while core metabolic genes like frdC are generally conserved, recombination events can introduce subtle sequence variations that affect expression levels and protein functionality .

  • Strain-Specific Expression Patterns:

    • High-virulence strains often show coordinated expression of metabolic genes including the frd operon

    • Carbapenem-resistant K. pneumoniae (CRKP) strains display altered expression patterns of metabolic genes

    • Sequence type 11 (ST11) strains, prominent in China, show characteristic recombination patterns affecting metabolic gene clusters

  • Functional Consequences:
    Recombination events involving the frd operon can result in:

    • Altered promoter regions affecting transcriptional regulation

    • Amino acid substitutions impacting protein-protein interactions within the complex

    • Changes in codon usage affecting translation efficiency

Research has demonstrated that chromosomal recombination events contribute to genetic diversification and ultimate success of many bacterial pathogens. In K. pneumoniae, horizontal transfer of genetic material appears to be a crucial element driving molecular evolution, potentially including metabolic genes like frdC .

How can contradictory data regarding frdC function be reconciled in experimental studies?

When faced with contradictory data regarding frdC function, researchers should employ a structured approach to contradiction resolution:

  • Parameter-Based Analysis Framework:
    Using the (α, β, θ) notation from contradiction pattern analysis :

    • α: number of interdependent items (e.g., genes in the frd operon)

    • β: number of contradictory dependencies defined by domain experts

    • θ: minimal number of required Boolean rules to assess these contradictions

  • Common Sources of Contradictions in frdC Studies:

Contradiction TypePossible ExplanationsResolution Approach
Strain-specific differencesGenetic background variationsSequence the complete frd operon and regulatory regions
Growth condition variationsDifferences in media compositionStandardize growth conditions and media components
Methodological differencesVariations in assay sensitivityCompare methods directly using reference strains
Genetic compensationActivation of alternative pathwaysPerform transcriptomic analysis of mutant strains
  • Structured Resolution Framework:

    • Replicate experiments under identical conditions

    • Test multiple independent mutants of the same gene

    • Perform complementation studies with controlled expression

    • Validate phenotypes with multiple methodological approaches

    • Consider epistatic interactions with other metabolic genes

For example, apparent contradictions in the role of frdC in oxidative stress response might be reconciled by considering the dual functionality of the enzyme under different conditions or by examining strain-specific genetic contexts that might contain compensatory mechanisms .

What statistical approaches are most appropriate for analyzing frdC expression data across different experimental conditions?

For analyzing frdC expression data across different experimental conditions, several statistical approaches are recommended based on experimental design and data characteristics:

  • For Comparing Expression Levels Across Conditions:

    • Differential Expression Analysis:

      • For normally distributed data: ANOVA followed by post-hoc tests

      • For non-parametric data: Kruskal-Wallis with post-hoc Mann-Whitney U tests

      • For time-course experiments: Repeated measures ANOVA or mixed-effects models

  • For Multi-Gene Expression Correlation:

    • Correlation Analysis:

      • Pearson correlation for linear relationships

      • Spearman correlation for monotonic relationships

      • Hierarchical clustering for identifying gene expression patterns

  • For Complex Experimental Designs:

  • For Pathway Analysis:

    • Enrichment Analysis:

      • Gene set enrichment analysis (GSEA)

      • Pathway enrichment analysis

      • Functional annotation clustering

  • For Handling Batch Effects and Confounding Variables:

    • Normalization Methods:

      • Quantile normalization

      • Batch effect correction with ComBat or similar tools

      • Principal component analysis (PCA) for identifying major sources of variation

When selecting statistical approaches, consider the experimental design, sample size, distribution characteristics, and the specific hypotheses being tested. For complex datasets involving multiple genes and conditions, multivariate approaches like principal component analysis or partial least squares discriminant analysis might provide more comprehensive insights .

How do I interpret discrepancies between in vitro and in vivo studies of recombinant frdC function?

Interpreting discrepancies between in vitro and in vivo studies of recombinant frdC function requires systematic analysis of the fundamental differences between these experimental systems:

  • Common Discrepancy Patterns:

Observation TypeIn Vitro FindingsIn Vivo FindingsPossible Explanation
Enzyme activityHigh specific activityModerate contribution to metabolismComplex regulatory networks modulate activity in vivo
Growth phenotypeMinimal growth defect in rich mediaSignificant colonization defectsHost environment presents nutritional constraints not replicated in vitro
ROS contributionMajor contributor to ROSVariable oxidative stress phenotypesHost antioxidant defense systems alter redox environment
  • Systematic Interpretation Framework:

    • Environmental Factors: In vivo environments present complex nutrient availability, host defense mechanisms, and physical constraints not replicated in vitro.

    • Genetic Context: Compensatory mechanisms may operate differently in vivo due to host-induced transcriptional changes.

    • Temporal Dynamics: In vivo infections progress through distinct phases, each with different metabolic requirements.

  • Reconciliation Approaches:

    • Develop more physiologically relevant in vitro models

    • Use ex vivo systems (tissue explants, organoids) as intermediate models

    • Perform in vivo transcriptomics to identify condition-specific regulation

    • Create reporter strains to monitor frdC expression in real-time during infection

Studies in C. jejuni demonstrated that frdA mutants showed significantly reduced chicken colonization while maintaining partial functionality in vitro, highlighting the importance of in vivo verification . Similarly, analysis of K. pneumoniae metabolism has shown that strains lacking certain metabolic genes exhibit environment-specific fitness defects, being essential in some host niches but dispensable in others .

What potential exists for targeting frdC in the development of novel antimicrobial strategies?

The potential for targeting frdC in novel antimicrobial strategies stems from its essential role in anaerobic metabolism and potential contributions to virulence:

  • Target Validation Evidence:

    • frdC's role in metabolic adaptation makes it potentially essential during specific infection stages

    • The membrane localization of frdC provides accessibility for drug targeting

    • Limited homology to human proteins reduces potential off-target effects

  • Potential Targeting Approaches:

ApproachMechanismDevelopment Status
Small molecule inhibitorsDirect binding to frdC to disrupt electron transportEarly research phase
Peptide inhibitorsDisruption of frdC assembly into the complete complexPreclinical studies
Antisense oligonucleotidesReduction of frdC expressionProof-of-concept
Antibody-antibiotic conjugatesTargeted delivery of antibiotics to frd-expressing bacteriaEarly development
  • Strain-Specific Considerations:
    Researchers must account for the genetic diversity of K. pneumoniae strains, particularly in regions like China where carbapenem-resistant K. pneumoniae (CRKP) sequence type 11 (ST11) strains are prevalent .

  • Combination Therapy Potential:
    Targeting frdC could be particularly effective in combination with conventional antibiotics or compounds that induce oxidative stress, creating synergistic effects that reduce the emergence of resistance.

The development of subunit vaccines targeting outer membrane proteins in K. pneumoniae has shown promising results, suggesting that targeting specific bacterial components can be effective . Similar approaches targeting metabolic enzymes like frdC, particularly during anaerobic infection stages, could provide complementary strategies for combating antibiotic-resistant K. pneumoniae infections .

How might CRISPR-Cas9 technology be optimized for studying frdC function in K. pneumoniae?

CRISPR-Cas9 technology offers powerful approaches for studying frdC function in K. pneumoniae, with several optimization strategies:

  • System Selection and Optimization:

    • CRISPR Interference (CRISPRi): Using catalytically inactive dCas9 for gene repression rather than deletion

    • Base Editing: For introducing point mutations without double-strand breaks

    • Prime Editing: For precise insertions or deletions without donor templates

  • Guide RNA Design Considerations:

    • Target unique regions of frdC to prevent off-target effects

    • Design multiple gRNAs targeting different regions of the gene

    • Use K. pneumoniae-specific promoters for gRNA expression

    • Consider codon optimization for the Cas9 gene to enhance expression

  • Delivery Methods:

    • Electroporation of ribonucleoprotein complexes for transient editing

    • Temperature-sensitive plasmids for curable CRISPR systems

    • Conjugative plasmids for strain-specific delivery

  • Validation Strategies:

    • Quantitative PCR to confirm gene expression changes

    • Western blotting to verify protein level alterations

    • Enzymatic assays to assess functional consequences

    • Phenotypic assays to determine biological impacts

For precise manipulation of frdC, consider tunable expression systems that allow for controlled gene expression rather than complete knockout, enabling the study of frdC dose-dependent effects on metabolism and virulence .

What are the key considerations for designing multi-epitope recombinant vaccines incorporating frdC antigens?

Designing multi-epitope recombinant vaccines incorporating frdC antigens requires careful consideration of multiple factors to ensure safety, immunogenicity, and protective efficacy:

  • Epitope Selection and Validation:

    • Conduct immunoinformatic analysis to identify potential B-cell and T-cell epitopes within frdC

    • Select conserved epitopes present across diverse K. pneumoniae strains

    • Validate epitope immunogenicity using synthetic peptides

    • Exclude epitopes with homology to human proteins to prevent autoimmune responses

  • Construct Design Principles:

ComponentPurposeDesign Considerations
Carrier proteinEnhance immunogenicitySelect immunogenic yet safe protein (e.g., tetanus toxoid fragment)
Linker sequencesPrevent epitope interferenceUse flexible linkers (GGGGS) between epitopes
Adjuvant sequencesBoost immune responseInclude built-in adjuvant sequences like flagellin D0/D1 domains
Targeting sequencesDirect to antigen-presenting cellsAdd mannose receptor targeting peptides
  • Expression System Selection:

    • Mammalian systems for proper folding and post-translational modifications

    • Bacterial systems for high-yield production

    • Cell-free systems for rapid prototyping

  • Safety and Immunogenicity Testing:
    Follow a structured approach similar to the r-AK36 vaccine development:

    • Hyperimmune sera reactivity testing against native proteins

    • Cross-reactivity assessment with other Gram-negative bacteria

    • Analysis of antibody isotype distribution (Th1/Th2 balance)

    • Assessment of antimicrobial effects of vaccine-induced antibodies

    • Evaluation of splenocyte proliferation in immunized animals

    • Measurement of protective cytokine induction (IL-2, IFN-γ)

    • Challenge studies with lethal doses of K. pneumoniae

  • Efficacy Evaluation:
    Studies with the recombinant multi-epitope outer membrane protein vaccine r-AK36 showed ~80% survival of immunized mice when challenged with 3 × LD100 dose, providing a benchmark for efficacy evaluation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.