Recombinant Klebsiella pneumoniae subsp. pneumoniae Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
frdD; KPN78578_44800; KPN_04550; Fumarate reductase subunit D; Fumarate reductase 13 kDa hydrophobic protein; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Target Names
frdD
Target Protein Sequence
MINPNPKRSDEPVFWGLFGAGGMWGAIVAPVMVLLVGILLPLGLAPADAFSYERVLAFAQ SFIGRAFIFLMIVLPLWCGLHRIHHAMHDLKIHVPNGKWVFYGLAAILSVITLVGVLFI
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is employed during anaerobic growth, while succinate dehydrogenase functions in aerobic growth. FrdD anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of fumarate reductase in K. pneumoniae?

Fumarate reductase catalyzes the reduction of fumarate to succinate in the terminal step of anaerobic electron transfer. In K. pneumoniae, as in other Enterobacteriaceae, this enzyme is crucial for anaerobic respiration when oxygen is limited and alternative electron acceptors like fumarate are used. The enzyme complex allows the organism to generate energy through oxidative phosphorylation under anaerobic conditions, contributing to its metabolic versatility .

Methodology for studying function:

  • Growth curve analysis comparing wild-type and frdD knockout strains under anaerobic conditions with fumarate as the terminal electron acceptor

  • Enzyme activity assays measuring the conversion of fumarate to succinate

  • Membrane potential measurements to assess the contribution to electron transport chain

How is the fumarate reductase complex structured in K. pneumoniae?

Based on homology with E. coli, the fumarate reductase complex in K. pneumoniae is likely a membrane-bound enzyme composed of four nonidentical polypeptides: FrdA, FrdB, FrdC, and FrdD. The FrdA subunit (approximately 69 kDa) contains covalently bound flavin adenine dinucleotide. The FrdB protein (27 kDa) contains iron-sulfur centers. The FrdC and FrdD polypeptides (15 and 13 kDa, respectively) are integral membrane proteins that anchor the catalytic FrdAB domain to the cytoplasmic membrane .

Research methods to confirm structure:

  • Protein purification and size-exclusion chromatography

  • Western blotting using antibodies against each subunit

  • Blue native PAGE to analyze intact complex

  • Cross-linking studies to examine subunit interactions

How is the frd operon regulated in K. pneumoniae?

The frd operon in K. pneumoniae is likely regulated in a manner similar to E. coli, where expression is controlled by environmental factors including oxygen, nitrate, and fumarate. Under anaerobic conditions, the Fnr protein activates frd operon expression. Nitrate has been shown to repress frd expression through a mechanism independent of Fnr regulation. Fumarate tends to induce frd expression under anaerobic conditions .

Experimental approaches to study regulation:

  • Construction of frdA'-lacZ fusion strains to monitor promoter activity

  • qRT-PCR analysis of frd mRNA levels under varying growth conditions

  • Chromatin immunoprecipitation (ChIP) to identify regulatory proteins binding to the frd promoter

  • DNA footprinting to map binding sites of regulatory proteins

What methods are most effective for inducing recombinant frdD expression in laboratory settings?

For optimal expression of recombinant K. pneumoniae frdD:

  • Vector selection: Use low-copy vectors with inducible promoters (e.g., pBAD, pET) to control expression levels

  • Growth conditions: Culture cells anaerobically with fumarate as electron acceptor to mimic natural induction conditions

  • Temperature: Maintain growth at 37°C initially, then reduce to 30°C upon induction to improve protein folding

  • Media formulation: Use minimal media supplemented with specific ions (particularly calcium and magnesium) which may enhance expression

  • Induction parameters: Use moderate inducer concentrations to prevent formation of inclusion bodies

Expression SystemAdvantagesDisadvantagesOptimal Induction Parameters
pET/T7High expressionPotential toxicity0.1-0.5 mM IPTG, 30°C, 4-6 hours
pBAD/araBADTight regulationLower yield0.2% arabinose, 30°C, 6-8 hours
pTacModerate expressionLeaky expression0.5 mM IPTG, 30°C, 4-8 hours

What is the optimal protocol for generating K. pneumoniae frdD knockout mutants?

The λ Red recombinase system provides an efficient method for constructing isogenic mutants in K. pneumoniae:

  • Prepare electrocompetent K. pneumoniae cells containing the λ Red recombinase plasmid (pKD46)

  • Design PCR primers with:

    • 40-45 bp homology to regions flanking frdD

    • 20 bp homology to antibiotic resistance cassette

  • Amplify resistance cassette with these primers

  • Electroporate the PCR product into prepared cells

  • Select transformants on appropriate antibiotic media

  • Confirm knockout via colony PCR using primers outside the targeted region

  • Verify absence of secondary mutations through genome sequencing

  • For unmarked mutations, use FLP recombinase system to remove the resistance marker

Troubleshooting tips:

  • Low transformation efficiency may result from capsule interference; consider using capsule-deficient strains or adding EDTA during competent cell preparation

  • Confirm complete deletion using both PCR and functional assays (anaerobic growth with fumarate)

  • Perform complementation studies to verify phenotype is due to frdD deletion

What are the most reliable methods for detecting and quantifying K. pneumoniae frdD expression?

For accurate detection and quantification of frdD expression:

  • Droplet digital PCR (ddPCR):

    • Highest sensitivity (detection limit of ~1.1 copies/μL)

    • Less susceptible to inhibition from sample matrix

    • Superior for absolute quantification

    • Requires specialized equipment

  • Real-time quantitative PCR (qPCR):

    • Good sensitivity (~10 copies/μL)

    • More widely available equipment

    • More affected by inhibitors in complex samples

    • Requires careful primer design specific to K. pneumoniae frdD

  • RNA-seq:

    • Provides transcriptome-wide context

    • Allows comparison of frdD expression with other genes

    • Requires bioinformatic expertise for analysis

  • Western blotting:

    • Directly measures protein levels

    • Requires specific antibodies against FrdD

    • Semi-quantitative unless specialized techniques are used

A comprehensive approach combines transcript and protein analysis to account for post-transcriptional regulation.

How does recombination influence the evolution of the frd operon in clinical K. pneumoniae isolates?

Chromosomal recombination events contribute significantly to genetic diversification in bacterial pathogens like K. pneumoniae. While no specific recombination events in the frd operon have been documented, K. pneumoniae demonstrates extensive recombination capabilities that shape its genome:

  • Whole-genome sequencing studies of clinical isolates reveal large recombination events, such as the 154-kb and 485-kb regions documented in carbapenem-resistant strains

  • Analysis methodology for identifying recombination:

    • Comparative genomic analysis using tools like Gubbins or ClonalFrameML

    • Examination of SNP density patterns to identify potential recombination hotspots

    • Analysis of GC content and codon usage in suspected recombination regions

  • Potential impact on frd operon:

    • Recombination could introduce variations in regulatory regions affecting expression

    • Horizontal gene transfer might introduce novel alleles from related species

    • Recombination between different K. pneumoniae strains could lead to mosaic frd operons with altered functionality

  • Research approach:

    • Sequence and compare frd operons across diverse clinical isolates

    • Identify signatures of recombination using population genomics tools

    • Correlate genetic variations with phenotypic differences in anaerobic growth

What role might frdD play in antimicrobial resistance mechanisms in K. pneumoniae?

While direct evidence linking frdD to antimicrobial resistance is limited, several hypotheses and research directions are worth exploring:

  • Membrane integrity: As an integral membrane protein, FrdD contributes to membrane organization. Alterations in membrane composition can affect permeability to antibiotics, particularly in clinical isolates under selective pressure

  • Metabolic adaptations: The ability to use alternative electron acceptors (mediated by the Frd complex) allows K. pneumoniae to survive in oxygen-limited environments, such as biofilms or abscesses, where antibiotic efficacy may be reduced

  • Stress response connections: Regulation networks controlling frd expression may overlap with those governing stress responses, including antibiotic exposure

  • Experimental approaches:

    • Compare minimum inhibitory concentrations (MICs) between wild-type and frdD mutants

    • Assess biofilm formation capabilities and antibiotic tolerance

    • Perform transcriptomic analysis under antibiotic stress to identify potential regulatory connections

    • Use fluorescently-labeled antibiotics to assess membrane permeability changes

How can structural studies of FrdD contribute to drug development against K. pneumoniae?

Structural characterization of FrdD offers several avenues for therapeutic development:

  • Membrane protein crystallization techniques:

    • Detergent screening to find optimal solubilization conditions

    • Lipidic cubic phase crystallization for membrane proteins

    • Cryo-electron microscopy for high-resolution structural determination

    • X-ray crystallography at synchrotron radiation facilities

  • Structure-based drug design applications:

    • Identification of pocket binding sites unique to K. pneumoniae FrdD

    • Virtual screening of compound libraries against solved structures

    • Fragment-based drug discovery approaches

    • Design of peptidomimetics that disrupt FrdD-FrdC interactions

  • Potential advantages as a drug target:

    • Essential for anaerobic growth, which may be relevant in infection sites

    • Membrane localization makes it potentially accessible to drugs

    • Differences from human proteins may allow selective targeting

  • Methodological challenges:

    • Membrane proteins are notoriously difficult to crystallize

    • Functional studies require reconstitution in membrane mimetics

    • Validation of interactions requires specialized biophysical techniques

What are the critical controls when working with recombinant K. pneumoniae frdD?

Robust experimental design requires appropriate controls:

  • Genetic controls:

    • Empty vector control for expression studies

    • Point mutant controls (site-directed mutagenesis of conserved residues)

    • Complementation with wild-type frdD to restore phenotypes

    • E. coli frdD as a heterologous control

  • Experimental controls:

    • Growth curve analysis under both aerobic and anaerobic conditions

    • Inclusion of measurement standards in enzyme assays

    • Technical and biological replicates (minimum n=3)

    • Assessment of all four Frd subunits when studying complex formation

  • Validation controls:

    • Multiple detection methods (e.g., antibody-based and activity-based)

    • Testing in different strain backgrounds

    • Confirmation of genetic modifications by sequencing

  • Negative controls that must show no activity:

    • Reactions without substrate

    • Heat-inactivated enzyme preparations

    • Strains with complete deletion of the frd operon

Framework for Reliable Experimental Design (FRED) principles should be applied to ensure reproducibility and reliability of results .

How do you troubleshoot unsuccessful expression of recombinant K. pneumoniae frdD?

When expression attempts fail, systematic troubleshooting is essential:

  • Common issues and solutions:

    • Protein toxicity: Use tightly regulated expression systems; express at lower temperatures (16-25°C)

    • Inclusion body formation: Reduce induction levels; add solubility tags (MBP, SUMO); use specialized strains

    • Proteolytic degradation: Add protease inhibitors; use protease-deficient strains

    • Poor membrane integration: Co-express with chaperones; use specialized membrane protein expression strains

  • Diagnostic approaches:

    • Western blot analysis of different cellular fractions

    • Mass spectrometry to confirm presence of protein fragments

    • RT-PCR to verify transcription is occurring

    • Fusion with reporter proteins to track expression and localization

  • Optimization strategy:

    • Test multiple expression strains systematically

    • Vary induction parameters (temperature, inducer concentration, duration)

    • Screen different fusion tags and construct designs

    • Consider whole-operon expression if individual subunits are unstable

  • Expression of membrane proteins like FrdD often requires co-expression of partner proteins (FrdC) for proper folding and stability

How does K. pneumoniae frdD compare to homologs in other bacterial species?

Comparative analysis reveals important insights about evolutionary conservation and species-specific adaptations:

What are the challenges in expressing K. pneumoniae frdD in heterologous systems?

Expression of K. pneumoniae frdD in heterologous systems presents several challenges:

  • Membrane protein-specific issues:

    • Differences in membrane composition between expression hosts can affect folding

    • Overexpression can overwhelm membrane insertion machinery

    • Toxicity due to membrane disruption

    • Differences in lipid composition affecting protein stability

  • Complex assembly challenges:

    • FrdD requires FrdC for proper membrane association and stability

    • Functional fumarate reductase requires all four subunits (FrdA, FrdB, FrdC, FrdD)

    • Expression of individual subunits may not yield stable protein

  • Host-specific factors:

    • Codon usage optimization may be necessary for efficient translation

    • Expression temperature may need adjustment (30°C often optimal)

    • Specialized E. coli strains designed for membrane protein expression may improve yields

  • Recommended approach:

    • Co-expression of multiple or all frd operon genes

    • Use of rhamnose or arabinose inducible promoters for fine-tuned expression

    • Incorporation of affinity tags for purification

    • Expression in anaerobic conditions to mimic native environment

What is the optimal protocol for purifying recombinant K. pneumoniae FrdD protein?

Purification of membrane proteins like FrdD requires specialized techniques:

  • Preparation of membrane fraction:

    • Culture cells under anaerobic conditions to induce expression

    • Harvest cells and disrupt by French press or sonication

    • Remove unbroken cells and debris by low-speed centrifugation

    • Isolate membrane fraction by ultracentrifugation (100,000 × g for 1 hour)

  • Solubilization:

    • Screen detergents (n-dodecyl-β-D-maltoside, digitonin, CHAPSO) for optimal solubilization

    • Include glycerol (10-20%) and salt (300-500 mM NaCl) to stabilize the protein

    • Solubilize at 4°C with gentle rotation for 1-2 hours

  • Affinity purification:

    • For His-tagged constructs, use Ni-NTA resin with imidazole gradient elution

    • For co-purification of the entire complex, tag only one subunit

    • Include detergent in all buffers at concentrations above critical micelle concentration

  • Further purification:

    • Size exclusion chromatography to separate monomeric from aggregated protein

    • Ion exchange chromatography for additional purity if needed

    • Blue native PAGE to assess complex integrity

  • Quality control:

    • Western blot to confirm identity

    • Mass spectrometry for accurate mass determination

    • Dynamic light scattering to assess homogeneity

    • Functional assays to confirm activity after purification

How do you design primers for amplifying and cloning K. pneumoniae frdD?

Effective primer design is critical for successful amplification and cloning:

  • Sequence analysis prerequisites:

    • Obtain complete genome sequence of target K. pneumoniae strain

    • Analyze frd operon structure and identify frdD boundaries

    • Check for strain-specific variations that might affect primer binding

  • Primer design principles:

    • Design primers with ~20-25 nucleotides complementary to target sequence

    • Maintain GC content between 40-60%

    • Ensure melting temperatures of forward and reverse primers are within 5°C

    • Check for self-complementarity and hairpin formation using tools like OligoAnalyzer

    • Include restriction sites with 4-6 base overhangs for directional cloning

  • Specialized considerations for membrane proteins:

    • Include or exclude signal sequences based on expression strategy

    • Consider fusion tag placement (N or C-terminal) based on membrane topology

    • Design primers that maintain the reading frame with fusion partners

  • Example primer set for amplifying K. pneumoniae frdD with NdeI and XhoI sites:

    • Forward: 5'-GGAATTCCATATGXXXXXXXXXXXXXXXXX-3' (where X represents K. pneumoniae frdD-specific sequence)

    • Reverse: 5'-CCGCTCGAGXXXXXXXXXXXXXXXX-3'

  • Validation of amplification:

    • Optimize PCR conditions with gradient PCR

    • Sequence amplified products before cloning

    • Use high-fidelity polymerases to minimize errors

What are emerging techniques that could advance studies of K. pneumoniae frdD?

Several cutting-edge approaches show promise for deepening our understanding:

  • Cryo-electron microscopy:

    • Enables visualization of membrane proteins in near-native states

    • Can resolve structures at near-atomic resolution

    • Allows study of the entire fumarate reductase complex embedded in membrane

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) to study dynamic interactions

    • Single-molecule tracking to examine membrane diffusion and localization

    • Atomic force microscopy to examine topography and mechanical properties

  • Advanced genetic methods:

    • CRISPR-Cas9 for precise genome editing in K. pneumoniae

    • CRISPRi for controlled gene repression without deletion

    • Droplet digital PCR for absolute quantification of expression levels

  • Computational approaches:

    • Molecular dynamics simulations of FrdD in membrane environments

    • Machine learning for prediction of protein-protein and protein-drug interactions

    • Systems biology modeling of anaerobic respiration networks

  • Potential applications:

    • Drug discovery targeting anaerobic metabolism

    • Biotechnological applications in biocatalysis

    • Understanding pathogenesis in oxygen-limited infection sites

How might understanding K. pneumoniae frdD contribute to addressing antimicrobial resistance?

The study of frdD has several potential applications in combating antimicrobial resistance:

  • Alternative therapeutic targets:

    • Anaerobic metabolism inhibitors may provide new treatment options

    • Targeting membrane protein complexes offers novel mechanisms of action

    • Disrupting fumarate reductase could impair survival in oxygen-limited infection sites

  • Physiological insights:

    • Understanding metabolic adaptations during infection

    • Elucidating survival mechanisms in biofilms where traditional antibiotics fail

    • Identifying metabolic vulnerabilities specific to resistant strains

  • Research approaches:

    • Screening for small molecule inhibitors of fumarate reductase

    • Structure-based design of peptidomimetics disrupting complex assembly

    • Combination therapy targeting both aerobic and anaerobic metabolism

  • Challenges and considerations:

    • Target must be essential for pathogenesis

    • Selectivity over human host proteins is critical

    • Pharmacokinetic properties must allow penetration to infection sites

    • Resistance development potential must be assessed

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.