Recombinant Klebsiella pneumoniae subsp. pneumoniae Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific requests for the format. Please indicate your preferred format in the order notes and we will fulfill your requirements to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. Should you require dry ice shipping, kindly notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; KPN78578_33980; KPN_03463; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Target Names
plsY
Target Protein Sequence
MSAIAPGLVLLAYLCGSISSAILVCRLAGLPDPRDSGSGNPGATNVLRIGGKGAAVAVLI FDVLKGMLPVWGAWALGLTPFWLGLVAIAACVGHIWPVFFHFRGGKGVATAFGAIAPIGL DLTGVMAGTWLLTILLSGYSSLGAIVSALIAPFYVWWFKPQYTFPVSMLSCLILLRHHDN IQRLWRRQESKIWTREKKKKTPEQK
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Klebsiella pneumoniae plsY and how does it differ from other acyltransferases?

PlsY from K. pneumoniae is a membrane-integral glycerol 3-phosphate acyltransferase with approximately 200 residues that catalyzes the committed step in bacterial phospholipid biosynthesis. High-resolution crystal structure analysis (1.48 Å) has revealed that plsY possesses a seven-transmembrane helix fold, unlike other acyltransferases . The protein contains three functionally important motifs: one for acylP binding (residues 35-46), another for G3P binding (residues 100-107), and a catalytic region (residues 185-197) .

PlsY differs fundamentally from conventional acyltransferases in several ways:

  • It contains no known acyltransferase motifs

  • It lacks eukaryotic homologs

  • It uses acyl-phosphate as an acyl donor, rather than acyl-CoA or acyl-carrier protein used by other acyltransferases

  • It employs a unique catalytic mechanism termed "substrate-assisted catalysis"

These structural differences make plsY an interesting target for both fundamental research and antimicrobial development.

What is the catalytic mechanism of plsY and how was it determined?

The catalytic mechanism of plsY represents a departure from the conventional "Asp-His dyad" mechanism utilized by thioester counterparts. Through crystallographic studies combined with functional analysis, researchers have determined that plsY employs a "substrate-assisted catalysis" mechanism .

In this novel mechanism:

  • Unlike conventional acyltransferases with the HX4D motif, plsY does not use an aspartate residue to raise the pKa of histidine for deprotonating G3P

  • Instead, the substrate itself plays a role in facilitating the reaction

  • The catalytically important residue His185 functions differently than in conventional acyltransferases

  • The acylation of G3P is accomplished without requiring a catalytic base from the enzyme

This mechanism was elucidated through a combination of high-resolution crystal structures (including substrate and product-bound states) and extensive mutagenesis studies, highlighting the unique nature of this enzyme in bacterial phospholipid biosynthesis .

How can researchers develop a reliable enzymatic assay for K. pneumoniae plsY activity?

A high-throughput lipid cubic phase (LCP)-based assay has been successfully developed to measure plsY activity in a lipid environment that closely mimics physiological conditions. This methodology overcomes critical challenges in measuring plsY activity and offers several advantages for researchers .

Methodology for LCP-based plsY assay:

  • Reconstitution phase:

    • Purify plsY protein (verify purity via SDS-PAGE)

    • Reconstitute purified plsY and acylP into LCP

    • Deposit the LCP mixture on the sidewall of microplate wells

  • Preparation phase:

    • Add Pi-free buffer to soak the LCP

    • This soaking step removes water-soluble Pi contaminants while retaining hydrophobic plsY and acylP in the lipid bilayer

    • Pre-load Pi-biosensor in the assay mix

  • Reaction phase:

    • Add G3P to initiate the reaction

    • G3P diffuses into LCP and reacts with acylP, producing lysoPA and Pi

    • Released Pi increases fluorescence of the Pi-biosensor

    • Monitor fluorescence increase as a function of time

The progress curves typically show an initial lag phase (~2 minutes) reflecting G3P equilibration between assay mix and LCP, followed by a linear phase used to calculate activity. Validation of product formation can be performed using thin layer chromatography (TLC) to detect lysoPA production .

What mutagenesis approaches are most effective for studying structure-function relationships in plsY?

Site-directed mutagenesis provides critical insights into the structure-function relationships of plsY by identifying essential residues for catalysis and substrate binding. Based on crystallographic data and prior functional studies, targeted mutagenesis of specific residues yields valuable information about their roles .

Key residues for mutagenesis studies:

ResidueFunctionMutation effectActivity retention
Thr41acylP binding (side chain)T41ASevere activity loss
Thr41acylP binding (side chain)T41S~50% activity
His92acylP binding (side chain)H92A~80% activity loss
His92acylP binding (side chain)Various substitutionsNo competent substitution found
Gly105Phosphate hole componentG105PNear abolishment of activity
Val106Phosphate hole componentV106PNear abolishment of activity
Lys104G3P binding via charge-charge interaction-Critical for function
His185Catalytically important-Critical for function

When designing mutagenesis experiments, researchers should:

  • Target residues in the three functional motifs (acylP binding, G3P binding, catalytic region)

  • Consider conservative substitutions to distinguish between backbone and side chain contributions

  • Use proline mutations when examining the importance of structural flexibility

  • Validate activity changes using the established LCP-based assay system

This systematic approach enables researchers to map the functional architecture of plsY and better understand its unique catalytic mechanism.

How conserved is plsY across different bacterial species and what are the implications for research?

PlsY represents an excellent research target because it exists exclusively and ubiquitously in bacteria with no eukaryotic homologs. It is the sole and essential GPAT (glycerol 3-phosphate acyltransferase) in most Gram-positive bacteria, including pathogens like Enterococcus faecium and Streptococcus pneumoniae .

Comparison of plsY orthologs:

When conducting research involving plsY from Klebsiella pneumoniae, it's important to understand its relationship to better-characterized orthologs:

  • The plsY from Aquifex aeolicus (aaPlsY) shares 37% identity and 55% similarity with the functionally characterized Streptococcus pneumoniae plsY (spPlsY)

  • All functionally critical residues are conserved across bacterial species

  • In some Gram-negative bacteria like Escherichia coli that contain both GPAT types (PlsB and PlsY), deletion of both PlsY and the acylP-synthesizing enzyme PlsX is lethal, demonstrating the essentiality of the PlsX/PlsY pathway

For researchers studying K. pneumoniae plsY, these comparative analyses suggest:

  • Findings from well-characterized orthologs may be applicable

  • Functional residues are likely conserved, though substrate specificity might vary

  • The essential nature of plsY makes it a universal bacterial target

When designing experiments with recombinant K. pneumoniae plsY, researchers should consider using thermostable orthologs (like aaPlsY) for initial structural studies while validating findings in the specific K. pneumoniae context.

How does plsY function in the context of capsular polysaccharide production in K. pneumoniae?

While plsY's primary function involves phospholipid biosynthesis, its role intersects with broader aspects of K. pneumoniae biology, including capsular polysaccharide (CPS) production, which is a major virulence factor .

K. pneumoniae's CPS serves multiple functions:

  • Forms an external coat that blocks host recognition

  • Prevents immune cells from binding to receptor proteins, inhibiting phagocytosis

  • Enables the pathogen to survive prolonged periods under adverse environmental conditions

  • Contributes to resistance against antimicrobial peptides

The intersection between phospholipid biosynthesis (plsY function) and CPS production occurs at several levels:

  • Both pathways utilize phosphate-containing precursors

  • Membrane architecture, influenced by phospholipid composition, affects CPS transport and assembly

  • Both systems contribute to antibiotic resistance mechanisms

Researchers investigating plsY in K. pneumoniae should consider these broader biological contexts, particularly when studying plsY inhibitors as potential antimicrobials, as effects on membrane composition may indirectly impact CPS production and virulence .

What makes plsY a promising target for antimicrobial development?

PlsY possesses several characteristics that make it an attractive target for novel antimicrobial development:

  • Essentiality: PlsY is the sole and essential GPAT in most Gram-positive bacteria, including multidrug-resistant pathogens identified by the WHO as the most dangerous threats

  • Bacterial exclusivity: PlsY exists exclusively in bacteria with no eukaryotic homologs, potentially minimizing off-target effects in humans

  • Unique mechanism: PlsY utilizes an unusual acyl-phosphate donor and a distinct catalytic mechanism unlike other acyltransferases, offering opportunities for selective inhibition

  • Structural data availability: High-resolution crystal structures (1.48 Å) provide atomic details of the active site, enabling structure-based drug design and virtual screening approaches

  • Validated screening assay: The development of a high-throughput enzymatic assay facilitates both virtual and experimental screening of potential inhibitors

Previous studies have already identified several acyl-sulfamates as potential PlsY-inhibiting antimicrobials for Staphylococcus aureus, demonstrating the feasibility of targeting this enzyme .

How might resistance to plsY inhibitors develop, and what strategies could mitigate this?

Understanding potential resistance mechanisms to plsY inhibitors is crucial for developing effective antimicrobial strategies. Based on current knowledge about K. pneumoniae resistance mechanisms and membrane adaptations, several possibilities exist:

Mitigation strategies:

  • Develop inhibitors targeting multiple residues within the active site

  • Consider dual-targeting approaches (e.g., inhibitors affecting both plsY and plsX)

  • Monitor for resistance development in clinical settings

  • Anticipate cross-resistance with other antimicrobials targeting bacterial membranes

These considerations should guide the design and evaluation of plsY inhibitors as potential antimicrobials.

How can researchers optimize expression and purification of recombinant K. pneumoniae plsY for structural studies?

Purifying membrane proteins like plsY presents significant challenges due to their hydrophobicity and tendency to aggregate. Based on successful approaches with plsY orthologs, researchers can optimize expression and purification as follows:

Expression optimization:

  • Consider using a thermostable ortholog (like aaPlsY) for initial structural studies while validating findings with K. pneumoniae plsY

  • Express with fusion tags that enhance solubility (e.g., MBP, SUMO)

  • Optimize induction conditions (temperature, IPTG concentration, duration)

  • Screen multiple expression hosts, including specialized strains designed for membrane proteins

Purification strategy:

  • Solubilize membranes with appropriate detergents (screening multiple options)

  • Employ affinity chromatography leveraging fusion tags

  • Incorporate size-exclusion chromatography to remove aggregates

  • Verify protein purity via SDS-PAGE

Crystallization considerations:

  • Use lipid cubic phase (LCP) crystallization methods, which have proven successful for plsY orthologs

  • Implement crystal screening in the presence of substrates or product analogs to stabilize the protein

  • Consider co-crystallization with inhibitors to capture different conformational states

Researchers should validate the functionality of purified protein using the established LCP-based enzymatic assay to ensure that the purified protein maintains its native activity .

What is the relationship between plsY function and antibiotic resistance mechanisms in K. pneumoniae?

The relationship between plsY function and antibiotic resistance in K. pneumoniae represents an important research frontier, particularly given the emergence of multidrug-resistant strains. Evidence suggests several intriguing connections:

  • Membrane remodeling mechanisms:

    • K. pneumoniae can develop colistin resistance through mgrB inactivation, which triggers PhoPQ-governed lipid A remodeling

    • This remodeling affects membrane structure and function, potentially influencing the local environment in which plsY operates

    • Modifications confer resistance not only to polymyxins but also to human antimicrobial peptides

  • Capsular polysaccharide (CPS) protection:

    • CPS forms an external coat that blocks host recognition and inhibits phagocytosis

    • CPS prevents immune cells from binding to receptor proteins on K. pneumoniae

    • CPS enables the pathogen to survive prolonged periods under adverse conditions

    • The relationship between membrane phospholipid composition (influenced by plsY) and CPS assembly/transport warrants further investigation

  • Virulence-resistance balance:

    • Contrary to common assumptions, some resistance mechanisms (like mgrB inactivation) can enhance virulence rather than diminish fitness

    • This suggests complex interactions between resistance development and pathogenicity that may involve membrane composition

Advanced research should investigate:

  • How inhibition of plsY affects established resistance mechanisms

  • Whether plsY activity is altered in antibiotic-resistant strains

  • The potential for combination therapies targeting both plsY and resistance mechanisms

Understanding these relationships could reveal new strategies for combating multidrug-resistant K. pneumoniae infections.

What emerging technologies could advance plsY research in K. pneumoniae?

Several cutting-edge approaches show promise for advancing plsY research:

  • Cryo-electron microscopy (cryo-EM):

    • While X-ray crystallography has provided high-resolution structures (1.48 Å), cryo-EM could capture dynamic states and conformational changes during catalysis

    • This approach might reveal additional details about substrate binding and product release

  • Molecular dynamics simulations:

    • Using the available crystal structures as starting points

    • Could elucidate conformational changes during catalysis

    • May help identify allosteric sites for alternative inhibition strategies

  • Native mass spectrometry:

    • Could provide insights into plsY interactions with other proteins in the phospholipid synthesis pathway

    • Might identify previously unknown binding partners

  • CRISPR-based approaches:

    • For precise genome editing to study plsY in its native context

    • Could facilitate rapid testing of resistance hypotheses

  • Microfluidic platforms:

    • For high-throughput screening of inhibitors

    • To study plsY activity under various physiological conditions

These technologies could help address key knowledge gaps and accelerate development of plsY-targeted antimicrobials.

How might computational approaches enhance structure-based drug design targeting plsY?

The availability of high-resolution crystal structures of plsY creates opportunities for sophisticated computational approaches to drug discovery:

  • Virtual screening strategies:

    • The atomic details of the active site enable rapid in silico assessment of large compound libraries

    • This approach is more cost-effective and time-efficient than experimental high-throughput screening

    • Focus should be placed on the three key functional regions: acylP binding site, G3P binding site, and catalytic region

  • Fragment-based drug design:

    • Identify small molecular fragments that bind to different regions of the active site

    • Link promising fragments to create high-affinity inhibitors

    • Leverage knowledge of key residues (Thr41, His92, Lys104, His185) for targeted design

  • Molecular dynamics simulations:

    • Simulate inhibitor binding and dissociation kinetics

    • Identify transient binding pockets that may not be visible in static crystal structures

    • Understand conformational changes induced by inhibitor binding

  • Machine learning approaches:

    • Train models on existing acyl-sulfamate inhibitors identified for S. aureus plsY

    • Generate novel structures with improved properties

    • Predict resistance-prone mutations to guide inhibitor design

These computational approaches should be integrated with experimental validation using the established LCP-based assay, creating an iterative design-test cycle to accelerate development of effective plsY inhibitors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.