Recombinant Klebsiella pneumoniae subsp. pneumoniae Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; KPN78578_36540; KPN_03691; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Target Names
mscL
Target Protein Sequence
MSFLKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVT LRDAQGDVPAVVMHYGVFIQNVFDFIIVAFAIFMAIKLMNKLNRKKEEAPAAPPAPSKEE VLLSEIRDLLKEQNNRS
Uniprot No.

Target Background

Function

This channel opens in response to membrane lipid bilayer stretch forces. It may play a regulatory role in cellular osmotic pressure changes.

Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the structure of MscL relate to its function?

The structure of MscL directly correlates with its mechanosensing function. MscL contains two transmembrane helices that form a funnel-shaped permeation pathway, with a larger opening facing the periplasmic surface and the narrowest point near the cytoplasm . At this narrowest point, the pore is constricted by specific residues in the channel.

The transmembrane pockets (TM pockets) play a crucial role in sensing membrane tension. According to the "lipid-moves-first" model, the number of lipid acyl chains occupying these TM pockets determines the conformational state of the protein . When lateral tension increases in the membrane, lipids move from these pockets to the bulk bilayer, destabilizing the closed structure and promoting channel opening .

Specific mutations in key regions can significantly affect channel function. For instance, the L89W mutation in Mycobacterium tuberculosis MscL (corresponding to positions in the M94 region in E. coli MscL) can stabilize expanded subconducting states by hindering the penetration of lipid acyl chains into the TM pockets . This demonstrates how structural modifications at key positions can directly impact channel gating.

Advanced spectroscopic studies using techniques like PELDOR (DEER) and ESEEM have enabled researchers to monitor conformational changes in MscL in response to mechanical stress or mutations, revealing the structural transitions that occur during channel activation .

What are the common methods to express recombinant MscL proteins?

Several approaches have proven effective for the expression of recombinant MscL proteins:

Specialized Expression Systems:
Engineered E. coli strains such as SuptoxR have been developed specifically for enhanced recombinant membrane protein production and show improved ability to express functional MscL-GFP . These specialized strains overcome the cytotoxicity often associated with membrane protein overexpression.

Optimization Strategies:

  • Selection of appropriate expression vectors with optimized promoters and fusion tags

  • Use of molecular chaperones or effectors to improve protein yield and stability

  • Expression of RraA proteins from different organisms (such as P. stuartii RraA) has been shown to enhance recombinant MscL-GFP production

Buffer and Storage Optimization:
For purified recombinant MscL, Tris-based buffer with 50% glycerol has been used, with storage recommendations at -20°C or -80°C for extended storage . Proper buffer optimization is critical for maintaining protein stability and function.

Functional Assessment Methods:
For characterization of expressed recombinant MscL, several techniques are employed:

  • Electron paramagnetic resonance (EPR) spectroscopic studies

  • Pulsed electron-electron double resonance (PELDOR/DEER)

  • Electron spin echo envelope modulation (ESEEM) spectroscopy

  • Electrophysiology measurements using patch-clamp techniques

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

How is MscL involved in bacterial responses to antimicrobial compounds?

MscL plays significant roles in bacterial interactions with antimicrobial compounds through several mechanisms:

Antibiotic Transport:
MscL can function as a portal for certain antibiotics to cross the bacterial membrane. The antibiotic dihydrostreptomycin (DHS) crosses the membrane primarily through MscL . DHS binds directly to MscL at the subunit interface near the constriction site, causing efflux of potassium and glutamate through the partially opened channel, followed by DHS passage into the cytoplasm .

Modulation by Small Molecules:
Specific compounds have been identified that directly target MscL and modify its function:

  • Compounds 011A and K05 bind to MscL and increase its sensitivity to lateral tension

  • These compounds enhance the potency of common antibiotics including dihydrostreptomycin, kanamycin, tetracycline, and ampicillin, making them potentially useful as antibiotic adjuvants

  • The binding site for these molecules is positioned at the cytoplasmic-membrane interface, with residue 97 identified as essential for binding in E. coli MscL

Targeting for Antimicrobial Development:
Research has identified MscL as a "druggable target" with significant potential for the development of new antimicrobial compounds . The discovery that structurally diverse agonists bind to a similar pocket near the central pore suggests this region could be a focus for rational drug design.

This emerging understanding of MscL's role in antimicrobial interactions is particularly significant given the rising concern about multidrug-resistant K. pneumoniae strains, which the WHO has listed as a "critical" priority for new antibiotic development .

What spectroscopic methods are most effective for studying MscL conformational changes?

Several advanced spectroscopic methods have proven particularly valuable for studying the conformational dynamics of MscL:

Pulsed Electron Paramagnetic Resonance (EPR) Techniques:

  • Pulsed electron-electron double resonance (PELDOR, also known as DEER) enables high-resolution distance measurements between spin-labeled residues in the protein

  • This technique requires site-directed spin labeling, typically using MTSSL spin labels attached to strategically introduced cysteine residues

  • PELDOR measurements have successfully demonstrated conformational changes consistent with expanded states in MscL variants

  • The technique allows for precise monitoring of distance changes between protein domains during channel gating

Electron Spin Echo Envelope Modulation (ESEEM) Spectroscopy:

  • Provides complementary information to PELDOR by characterizing the local environment of spin labels

  • Has been effectively used alongside PELDOR to fully characterize expanded states of MscL

  • Offers insights into water accessibility of different regions during channel opening

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Measures the rate of hydrogen-deuterium exchange in the protein backbone

  • Regions undergoing conformational changes typically show altered exchange rates

  • HDX-MS experiments have been instrumental in characterizing structural transitions during MscL gating

  • Provides information about solvent accessibility changes during channel activation

When these spectroscopic approaches are combined with functional studies (electrophysiology) and computational methods (molecular dynamics simulations), researchers can develop comprehensive models of MscL gating mechanisms. This integrative approach has been particularly effective for understanding how the L89W mutation in TbMscL stabilizes an expanded state by altering lipid interactions with transmembrane pockets .

How can MscL be targeted for novel antimicrobial development against K. pneumoniae?

MscL represents a promising target for novel antimicrobial strategies against K. pneumoniae through several research-validated approaches:

Direct Channel Modulation:
Several compounds have been identified that bind directly to MscL and alter its function:

  • Dihydrostreptomycin (DHS) binds at the subunit interface near the constriction site

  • Compounds 011A and K05 bind to MscL and increase its sensitivity to lateral tension

  • Compound 262, identified through in silico docking, is a potential MscL agonist

These direct modulators bind in or around the transmembrane pocket region, despite being structurally diverse, highlighting this area as a druggable target .

Antibiotic Adjuvant Development:
MscL modulators like 011A and K05 have been shown to increase the potency of commonly used antibiotics including dihydrostreptomycin, kanamycin, tetracycline, and ampicillin . This adjuvant approach is particularly promising given the widespread antimicrobial resistance in K. pneumoniae, including extended-spectrum β-lactamase (ESBL) production, which affects 64.4% of classical K. pneumoniae strains .

Structure-Based Drug Design:
Molecular knowledge of MscL binding sites can inform rational design approaches:

  • The cytoplasmic-membrane interface has been identified as a key binding region

  • Residue 97 in E. coli MscL has been demonstrated as essential for binding certain compounds

  • Structural differences between MscL from different bacterial species could potentially be exploited for selectivity

Combination Therapy Approaches:
Given the diversity of K. pneumoniae strains (with >150 deeply branching lineages identified ) and their varying resistance profiles, targeting MscL in combination with other antimicrobial strategies may be most effective. This could be particularly relevant for hypervirulent K. pneumoniae strains, which represent an emerging global health threat .

What challenges exist in characterizing MscL function across different K. pneumoniae strains?

Characterizing MscL function across different K. pneumoniae strains presents several significant challenges:

Genetic Diversity and Taxonomic Complexity:
K. pneumoniae exhibits remarkable genetic diversity, with genome sequencing studies revealing more than 150 deeply branching lineages . The K. pneumoniae species complex (KpSC) actually comprises multiple species, including K. pneumoniae (82.3%), K. variicola (2.5%), and K. quasipneumoniae (2.5%) . This diversity complicates efforts to characterize MscL across the species complex.

Phenotypic Variation:
K. pneumoniae strains exhibit diverse phenotypes, classified as classical (cl), presumptive hypervirulent (p-hv), and hypermucoviscous-like (hmv-like) . These phenotypic differences, particularly in capsule production, could significantly affect the membrane environment in which MscL functions. Since MscL is a mechanosensitive channel that responds to membrane tension, variations in capsule thickness and membrane composition may alter its gating properties.

Methodological Limitations:

  • Misidentification of species within the K. pneumoniae complex is common in clinical settings , potentially confounding research findings

  • Advanced techniques for MscL characterization, such as electrophysiology and spectroscopy, are technically challenging and not readily applicable to high-throughput screening of multiple strains

  • Maintaining consistent experimental conditions across diverse strains with different growth requirements and membrane compositions is difficult

Clinical Relevance Assessment:
Determining whether MscL functional differences between strains correlate with clinical outcomes, such as virulence or antibiotic resistance, requires integration of basic research with clinical studies. This is particularly challenging for hypervirulent K. pneumoniae (hvKp) strains, where "the ability to differentiate hvKp from classical Klebsiella pneumoniae is needed for optimal clinical management" .

Data Integration Challenges:
Combining genomic, structural, and functional data across the diverse K. pneumoniae species complex requires sophisticated bioinformatic approaches. While "genomic analyses confirmed the diverse population, including isolates belonging to hv clonal groups (CG) CG23, CG86, CG380 and CG25" , correlating this genomic diversity with functional differences in specific proteins like MscL remains challenging.

How do mutations in MscL affect channel gating and bacterial osmotic regulation?

Mutations in MscL can profoundly impact channel gating and bacterial osmotic regulation through several mechanisms:

Transmembrane Pocket Alterations:
The L89W mutation in Mycobacterium tuberculosis MscL (corresponding to positions in E. coli MscL) stabilizes an expanded subconducting state by hindering the penetration of lipid acyl chains into the transmembrane pockets . This mutation destabilizes the closed state by altering lipid-protein interactions critical for channel gating, demonstrating how single residue changes can significantly affect channel function.

Gating Threshold Modification:
Mutations can alter the tension threshold required for channel opening. The presence of the L89W mutation "reduced the threshold required for channel conductance in electrophysiology measurements, consistent with a subconducting state" . Such changes in gating threshold can affect how bacteria respond to osmotic challenges, potentially altering their survival under stress conditions.

Conformational Dynamics:
High-resolution distance measurements using PELDOR/DEER spectroscopy have shown that mutations can induce specific conformational changes in MscL . These structural alterations can be characterized using hydrogen-deuterium exchange mass spectrometry (HDX-MS) and ESEEM spectroscopy, revealing how mutations affect the protein's dynamic behavior.

Lipid-Protein Interactions:
The "lipid-moves-first" model suggests that MscL gating involves lipid movement from transmembrane pockets to the bulk bilayer . Mutations that affect these pockets can alter how the channel responds to membrane tension by changing the energetics of lipid-protein interactions.

Experimental Assessment Methods:
To fully characterize the effects of MscL mutations, researchers typically employ:

  • Electrophysiology to measure changes in channel conductance and gating threshold

  • Spectroscopic techniques (PELDOR/DEER, ESEEM) to monitor conformational changes

  • Molecular dynamics simulations to predict and analyze mutation effects

  • Osmotic shock survival assays to assess physiological consequences

Understanding how mutations affect MscL function is particularly relevant given the genomic diversity of K. pneumoniae, which exhibits "a wide spectrum of diversity, including variation within shared sequences" .

What is the role of MscL in Klebsiella pneumoniae pathogenesis and virulence?

The specific role of MscL in K. pneumoniae pathogenesis and virulence is not directly addressed in the search results, but several inferences can be made based on general MscL function and K. pneumoniae pathogenicity:

Osmotic Stress Response:
MscL functions as a "stretch-activated osmotic release valve in response to osmotic shock" . During infection, K. pneumoniae may encounter varying osmotic environments in different host tissues. The ability to regulate osmotic balance through MscL could be critical for bacterial survival during colonization and infection processes.

Relationship with Virulence Factors:
K. pneumoniae virulence is associated with several factors, particularly capsule production. Research has shown that "capsule amount differed in all p-hv strains and hmv-like produced higher capsule amounts than cl strains; these variations had important implications in phagocytosis and virulence" . The altered membrane environment resulting from different capsule production could potentially affect MscL function.

Contribution to Antibiotic Resistance:
MscL can serve as a portal for certain antibiotics. The antibiotic dihydrostreptomycin (DHS) "crosses the membrane primarily through MscL" . Alterations in MscL expression or function could potentially affect susceptibility to certain antibiotics, which is particularly relevant given that K. pneumoniae is "now recognized as an urgent threat to human health because of the emergence of multidrug-resistant strains" .

Potential Interaction with Host Defense Mechanisms:
Host defense against K. pneumoniae infection involves multiple mechanisms as outlined in search result . The stress responses triggered by host defense mechanisms, including changes in membrane tension or osmolarity, could potentially involve MscL-mediated responses, though this connection requires further investigation.

Research Approaches:
To explore MscL's role in K. pneumoniae pathogenesis, researchers might:

  • Create MscL knockout or functionally altered mutants and assess changes in virulence

  • Compare MscL expression levels between classical, hypervirulent, and hypermucoviscous strains

  • Examine MscL function under conditions mimicking different host environments

  • Investigate MscL's potential role in stress responses during host-pathogen interactions

How can recombinant MscL be used to develop vaccines against Klebsiella pneumoniae?

While the search results don't directly address MscL-based vaccines against K. pneumoniae, insights can be drawn from general approaches to K. pneumoniae vaccine development:

Antigen Identification and Evaluation:
Recombinant outer membrane proteins (KOMPs) have been evaluated as vaccine candidates against K. pneumoniae . A similar approach could be applied to MscL, which would involve:

  • Assessing MscL sequence conservation across diverse K. pneumoniae strains

  • Identifying surface-exposed epitopes that could be targeted by antibodies

  • Evaluating immunogenicity of recombinant MscL in animal models

Comprehensive Immune Response Assessment:
For KOMP vaccine candidates, researchers measured:

  • Antibody-mediated responses (IgG, IgG1, and IgG2a)

  • T-cell responses via KOMP-specific IFN-γ-, IL-4-, and IL-17A-secreting splenocytes

  • Opsonophagocytosis of K. pneumoniae using antiserum

Similar comprehensive immunological assessment would be essential for evaluating recombinant MscL as a vaccine candidate.

DNA Vaccine Approaches:
DNA vaccines encoding virulence factors have shown promise against K. pneumoniae. A study demonstrated that "co-immunization with pVAX1-YidR and pVAX1-IL-17 significantly augmented host adaptive immune responses and provided better protection against K. pneumoniae infections in vaccinated mice" . A similar approach using MscL-encoding DNA vaccines could be explored.

Adjuvant Optimization:
The use of IL-17 as a molecular adjuvant enhanced immune responses to K. pneumoniae antigens . Optimal adjuvant selection would be critical for any MscL-based vaccine.

Challenges and Considerations:
Several factors would determine the viability of MscL as a vaccine target:

  • Accessibility of MscL epitopes in intact bacteria

  • Conservation of MscL across clinically relevant strains

  • Potential for strain escape through MscL mutations

  • Protective efficacy against different K. pneumoniae phenotypes (classical, hypervirulent, hypermucoviscous)

Given the rising concern about multidrug-resistant and hypervirulent K. pneumoniae strains , innovative vaccine approaches targeting conserved proteins like MscL warrant investigation as part of the comprehensive strategy to address this significant public health threat.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.