Recombinant Klebsiella pneumoniae subsp. pneumoniae Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; KPN78578_00210; KPN_00022; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Target Names
lspA
Target Protein Sequence
MSKSICSTGLRWLWVVVAVLIIDLGSKFLILQNFALGETVPLFPSLNLHYARNYGAAFSF LADSGGWQRWFFSGIAIGICVVLTVLMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGF VVDMIDFYVGDWHFATFNLADSAICIGAALIVLEGFLPKPTVKEQA
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Lipoprotein signal peptidase (lspA) in Klebsiella pneumoniae?

Lipoprotein signal peptidase (LspA) is an essential membrane enzyme in Klebsiella pneumoniae that plays a crucial role in bacterial lipoprotein processing. LspA cleaves the signal peptide from prolipoproteins after they undergo lipidation at the N-terminal cysteine residue. This cleavage process is vital for proper lipoprotein localization and function, which directly impacts bacterial cell envelope integrity, virulence, and antimicrobial resistance . K. pneumoniae is a leading cause of antimicrobial-resistant healthcare-associated infections, and understanding the molecular mechanisms of enzymes like LspA is essential for developing targeted therapeutics .

What techniques are commonly used to express and purify recombinant K. pneumoniae lspA?

Recombinant K. pneumoniae LspA can be expressed and purified using several established techniques. Based on current protocols, the most effective method involves:

  • Cloning the lspA gene into an expression vector with a His-tag for purification

  • Expressing the protein in E. coli membrane fractions

  • Solubilizing the membrane pellet using detergents like fos choline-12 (FC12) at approximately 1.8% (w/v)

  • Purifying the protein using nickel immobilized metal affinity chromatography (Ni-IMAC)

  • Eluting with buffer containing 300 mM imidazole and 0.14% (w/v) FC12

  • Performing buffer exchange to remove imidazole using a PD-10 column

  • Confirming protein purity by SDS-PAGE and MALDI-TOF mass spectrometry

This expression and purification protocol yields stable LspA protein suitable for biochemical and structural studies.

What structural features are essential for lspA catalytic activity?

The catalytic activity of LspA depends on several key structural elements:

Structural FeatureFunction
β-cradle domainForms the foundation of the catalytic site
Periplasmic helix (PH)Controls substrate access to the active site
Transmembrane helicesAnchor the protein in the membrane and form the substrate binding cavity
Active site residuesDirectly involved in catalyzing signal peptide cleavage

The dynamic movement of these structural elements, particularly the repositioning of the periplasmic helix (PH), is crucial for enzyme function. The distance between the β-cradle and PH changes during catalysis, with at least three distinct conformational states (closed, intermediate, and open) observed through combined experimental approaches . These conformational changes facilitate substrate binding, catalysis, and product release.

How can hybrid experimental approaches be used to characterize lspA conformational dynamics?

Characterizing the conformational dynamics of LspA requires a multi-faceted experimental approach that overcomes the limitations of any single method. A hybrid methodology combining computational and spectroscopic techniques has proven most effective:

  • Molecular Dynamics (MD) Simulations:

    • Coarse-grained simulations using a palmitoyloleolylphosphatidylglycerol (POPG)/palmitoyloleoylphosphatidylethanolamine (POPE) (1:4 mole ratio) bilayer around LspA

    • Application of an elastic network between backbone beads

    • Temperature and pressure maintenance at 310 K and 1 bar respectively

    • This approach reveals nanosecond-scale conformational changes not observable in static structures

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Continuous wave (CW) EPR for monitoring local environment changes

    • Double Electron-Electron Resonance (DEER) for measuring longer-range distances

    • Site-directed spin labeling using MTSL/R1 spin labels at strategic residue positions

    • These techniques provide experimental validation of conformational states

  • X-ray Crystallography:

    • Captures high-resolution static snapshots of distinct conformational states

    • Provides reference structures for interpretation of dynamic data

This hybrid approach has successfully identified three distinct conformational states of LspA (closed, intermediate, and open) that were not observable through any single method alone .

What are the methodological challenges in studying membrane proteins like lspA?

Studying membrane proteins like LspA presents several methodological challenges that require specialized approaches:

  • Protein Expression and Purification:

    • Low expression yields due to toxicity and membrane integration requirements

    • Need for detergents to maintain protein stability and function

    • Risk of conformational alteration due to detergent micelle environment

  • Structural Analysis:

    • Difficulty in obtaining well-diffracting crystals for X-ray crystallography

    • Challenges in maintaining native membrane environment during analysis

    • Limited resolution of membrane protein structures

  • Functional Assays:

    • Requirement for lipid or detergent environments that mimic the native membrane

    • Complex substrate requirements involving both membrane and protein components

    • Need for specialized detection methods for activity monitoring

To overcome these challenges, researchers have developed specific methodologies:

  • Use of specialized membrane-mimetic systems (nanodiscs, lipid cubic phase)

  • Application of detergent screening to identify optimal solubilization conditions

  • Implementation of hybrid experimental approaches that combine complementary techniques

How can researchers distinguish between different conformational states of lspA?

Distinguishing between different conformational states of LspA requires a combination of techniques and careful data analysis:

Conformational Stateβ-cradle to PH DistanceCavity CharacteristicsDetection Methods
Closed6.2 ÅOccluded active siteDEER EPR with shorter distance distributions, CW EPR line shape analysis
Intermediate8-12 ÅPartially accessible active siteMost populated peak in globomycin-bound DEER distribution
Open>12 ÅTrigonal cavity accessible to substrateMD simulations, minor population in DEER distributions

To accurately identify these states, researchers should:

  • Perform site-directed spin labeling at multiple positions to triangulate conformational changes

  • Analyze both apo and inhibitor-bound states to detect population shifts

  • Use two-component CW EPR line shape analysis to detect conformational equilibria

  • Correlate MD simulation data with experimental distance measurements

  • Consider the membrane environment's effect on conformational distribution

This multi-parameter approach allows for robust identification of conformational states that may not be apparent from any single experimental technique.

How should researchers interpret contradictory data from different experimental approaches when studying lspA?

When faced with contradictory data from different experimental approaches, researchers should implement a systematic resolution process:

  • Evaluate methodological limitations:

    • Consider time scales accessible to each technique (ns for MD vs. μs-ms for EPR)

    • Assess environmental differences (detergent vs. lipid bilayer)

    • Recognize resolution limits of each method

  • Integrate complementary data sets:

    • Use MD simulations to interpret sparse experimental distance measurements

    • Compare crystal structures with solution-phase measurements

    • Create ensemble models that accommodate all experimental constraints

  • Validate with orthogonal approaches:

    • Introduce mutations that stabilize specific conformations

    • Test functional consequences of conformational changes

    • Use ligand binding to shift conformational equilibria

The case of LspA illustrates this approach effectively: crystal structures revealed only limited conformational states, while MD simulations suggested more extensive dynamics. EPR experiments then validated the presence of multiple conformational states, but with population distributions different from those predicted by MD. Only by integrating all these data sources could researchers develop a complete model of LspA conformational dynamics .

What computational frameworks are most effective for analyzing lspA sequence variants across Klebsiella strains?

For analyzing LspA sequence variants across Klebsiella strains, researchers should utilize computational frameworks that integrate genomic, structural, and functional data:

  • Genomic Surveillance Tools:

    • Kleborate provides a specialized framework for analyzing Klebsiella pneumoniae genomes

    • Enables systematic classification of K. pneumoniae population structure

    • Facilitates identification of virulence factors and antimicrobial resistance determinants across strains

  • Comparative Sequence Analysis:

    • Multiple sequence alignment tools to identify conserved vs. variable regions

    • Phylogenetic analysis to trace evolutionary relationships

    • Calculation of selection pressures on different protein domains

  • Structure-Function Prediction:

    • Homology modeling based on existing LspA structures

    • Molecular docking to assess inhibitor binding across variants

    • MD simulations to assess impact of sequence variations on conformational dynamics

  • Integration with Metagenomics:

    • Tools like Kleborate can detect and type K. pneumoniae from gut metagenomes

    • Enables correlation of LspA variants with colonization patterns

    • Supports investigation of LspA's role in chronic intestinal diseases

This integrated computational approach allows researchers to connect sequence variations to functional differences and potential therapeutic vulnerabilities across diverse Klebsiella strains.

How can researchers design experiments to study the role of lspA in Klebsiella pneumoniae pathogenesis?

Designing experiments to study LspA's role in K. pneumoniae pathogenesis requires a multi-level approach:

  • Genetic Manipulation Strategies:

    • Conditional knockdowns rather than direct knockouts (as LspA is essential)

    • Site-directed mutagenesis of catalytic residues to create partial loss-of-function variants

    • Complementation studies with LspA variants to confirm phenotype specificity

  • In Vitro Assessments:

    • Enzymatic activity assays using fluorogenic substrates

    • Membrane integrity evaluation using fluorescent dyes

    • Lipoprotein localization studies using cellular fractionation and immunoblotting

  • Cell Culture Models:

    • Adherence and invasion assays with epithelial cell lines

    • Macrophage survival and inflammatory response experiments

    • Biofilm formation quantification on relevant surfaces

  • Animal Model Selection:

    • Mouse models of pneumonia, urinary tract infection, or gut colonization

    • Evaluation of bacterial burden in relevant tissues

    • Assessment of inflammatory responses and tissue damage

    • Competitive index experiments with wild-type and LspA-deficient strains

  • Clinical Correlation:

    • Analysis of LspA sequence variation in clinical isolates

    • Correlation of LspA variants with antimicrobial resistance profiles

    • Assessment of LspA expression levels during infection

This comprehensive experimental design allows researchers to connect molecular mechanisms to pathogenesis and potential therapeutic interventions.

What are the optimal conditions for studying lspA inhibitors in vitro?

Establishing optimal conditions for studying LspA inhibitors in vitro requires careful consideration of multiple parameters:

ParameterOptimal ConditionsRationale
Protein preparationFreshly purified in appropriate detergent (e.g., FC12 at 0.14%)Maintains enzyme stability and activity
Buffer compositionpH 7.4, physiological salt concentration (150 mM NaCl)Mimics bacterial periplasmic environment
Membrane mimeticPOPG/POPE (1:4) lipid bilayer or nanodiscsReplicates native membrane environment
Temperature310 K (37°C)Physiologically relevant temperature
Substrate selectionFluorescently labeled prolipoprotein peptideAllows sensitive detection of enzymatic activity
Inhibitor solubilizationDMSO concentration <2%Minimizes solvent effects on enzyme activity
ControlsInclude known inhibitors (e.g., globomycin)Provides reference for inhibition potency

When evaluating inhibitors, researchers should:

  • Determine IC50 values under standardized conditions

  • Assess the inhibition mechanism (competitive, noncompetitive, or uncompetitive)

  • Evaluate the effect of inhibitors on different LspA conformational states

  • Confirm that inhibition translates to whole-cell activity against K. pneumoniae

  • Test against clinical isolates with varying antimicrobial resistance profiles

This systematic approach ensures reliable and translatable inhibitor characterization data.

How can researchers effectively monitor lspA conformational changes in response to substrate or inhibitor binding?

Monitoring LspA conformational changes requires specialized techniques sensitive to structural rearrangements:

  • EPR Spectroscopy Approaches:

    • Strategic placement of spin labels at positions that undergo significant movement

    • CW EPR to detect changes in local environment and dynamics

    • DEER EPR to measure distance changes between spin-labeled residues

    • Analysis of multi-component distance distributions to quantify population shifts

  • Fluorescence-Based Methods:

    • Site-specific labeling with environmentally sensitive fluorophores

    • Förster resonance energy transfer (FRET) to measure distance changes

    • Fluorescence quenching to detect solvent accessibility changes

    • Single-molecule FRET to observe conformational heterogeneity

  • Hydrogen-Deuterium Exchange Mass Spectrometry:

    • Quantification of solvent accessibility changes upon binding

    • Region-specific analysis of conformational flexibility

    • Time-resolved measurements to capture conformational kinetics

  • Computational Integration:

    • MD simulations to interpret experimental observables

    • Enhanced sampling techniques to capture rare conformational transitions

    • Construction of Markov state models to quantify conformational populations

A combined approach using multiple techniques provides the most comprehensive view of how substrate or inhibitor binding affects LspA conformations. For example, researchers have observed that globomycin binding shifts the conformational equilibrium of LspA toward intermediate and closed states, information that was only obtained by combining MD simulations with EPR distance measurements .

What emerging technologies show promise for advancing lspA research?

Several emerging technologies hold significant promise for advancing LspA research:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Near-atomic resolution structures of membrane proteins without crystallization

    • Potential to capture multiple conformational states in a single experiment

    • Visualization of LspA in complex with substrate or inhibitors

  • AlphaFold and Deep Learning Approaches:

    • Accurate prediction of LspA structures across Klebsiella variants

    • Structure-based prediction of conformational dynamics

    • Virtual screening of potential inhibitors against predicted structures

  • Single-Molecule Force Spectroscopy:

    • Direct measurement of forces involved in LspA conformational changes

    • Characterization of energy landscapes governing structural transitions

    • Evaluation of how inhibitors alter conformational energetics

  • Microfluidic Enzyme Assays:

    • High-throughput screening of LspA activity and inhibition

    • Minimal reagent consumption for expensive or scarce components

    • Integration with imaging to correlate activity with structural states

  • Genomic Surveillance Integration:

    • Tools like Kleborate for tracking LspA variants in clinical settings

    • Correlation of sequence variations with functional differences

    • Metagenomic detection of LspA in complex microbial communities

Combining these emerging technologies with established methods will accelerate understanding of LspA biology and development of targeted therapeutics.

How might understanding lspA conformational dynamics inform novel antibiotic development strategies?

Understanding LspA conformational dynamics provides several avenues for novel antibiotic development:

  • Conformation-Specific Targeting:

    • Design of inhibitors that preferentially bind to and stabilize inactive conformations

    • Development of allosteric inhibitors that prevent necessary conformational transitions

    • Creation of compounds that lock the enzyme in non-productive conformational states

  • Rational Structure-Based Design:

    • Targeting of transient pockets revealed only in specific conformational states

    • Optimization of inhibitor interactions with dynamic regions of the enzyme

    • Development of inhibitors that make contacts across multiple conformational states

  • Resistance Mitigation Strategies:

    • Identification of conformational dynamics conserved across LspA variants

    • Targeting of residues under functional constraints that cannot easily mutate

    • Design of inhibitors that maintain efficacy against predicted resistance mutations

  • Novel Screening Approaches:

    • Development of assays that specifically detect conformational state shifts

    • High-throughput screening for compounds that alter conformational equilibria

    • Computational screening against ensemble models rather than single structures

The identification of multiple conformational states in LspA (closed, intermediate, and open) provides specific structural targets for inhibitor development. For example, compounds that stabilize the closed conformation, which occludes the active site residues, could effectively inhibit enzyme function even without directly interacting with catalytic residues .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.