Recombinant Klebsiella pneumoniae subsp. pneumoniae Na (+)-translocating NADH-quinone reductase subunit E

Shipped with Ice Packs
In Stock

Description

Overview of Na+^++-Translocating NADH-Quinone Reductase Subunit E

NqrE is one of six subunits (NqrA–F) constituting the Na+^+-NQR complex, a respiratory enzyme unique to bacteria such as Klebsiella pneumoniae, Vibrio cholerae, and pathogenic Neisseria species . The recombinant form of NqrE is produced through heterologous expression in Escherichia coli, often fused with affinity tags (e.g., His-tag) for purification . Its primary role involves coordinating Fe-S clusters and facilitating electron transfer during NADH oxidation, coupled with Na+^+ translocation .

Membrane Topology

NqrE contains six transmembrane α-helices, as determined by PhoA/GFP fusion experiments in Vibrio cholerae . This topology positions key residues for interactions with neighboring subunits (NqrD and NqrB) and cofactors:

  • A conserved Cys4_4[Fe] center between NqrD and NqrE .

  • Riboflavin and ubiquinone binding sites near the cytoplasmic membrane interface .

Cofactor Assembly

NqrE requires maturation factors for functional integration into Na+^+-NQR:

  • NqrM (DUF539): Essential for delivering Fe to the Cys4_4[Fe] center .

  • ApbE: Flavoprotein transferase that covalently attaches FMN to Thr residues in subunits NqrB and NqrC .

Role in Na+^+-NQR Assembly

Inactivation of nqrM in Klebsiella pneumoniae disrupts Na+^+-NQR assembly, leading to incomplete complexes lacking NqrB, NqrD, and NqrE . For example:

Strain/ConstructNa+^+-Stimulated Activity (nmol·min⁻¹·mg⁻¹)dNADH:Menadione Activity
Wild-Type K. pneumoniae720 ± 801,300 ± 140
nqrM Mutant<5900 ± 150
Source: Adapted from Tables 3 and 4 in

Electron Transport Mechanism

NqrE participates in a proposed "electron loop" mechanism where FMN-bound electrons drive Na+^+ translocation via conformational changes in the membrane-embedded subunits . This process is inhibited by N,N′-dicyclohexylcarbodiimide (DCCD), which modifies carboxyl groups critical for Na+^+ binding .

Biotechnological and Pathogenic Significance

  • Antimicrobial Target: Na+^+-NQR is absent in humans, making NqrE a potential target for drugs against pathogens like Vibrio cholerae and Klebsiella pneumoniae .

  • Energy Metabolism: Enhances bacterial survival under low-proton conditions (e.g., marine environments) by maintaining Na+^+ gradients .

Unresolved Questions and Future Directions

  • The exact role of NqrE in stabilizing the Cys4_4[Fe] center remains unclear .

  • Structural studies using cryo-EM or X-ray crystallography are needed to resolve cofactor positioning and Na+^+ translocation pathways .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for precise delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is preferred, please contact us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For optimal long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
nqrE; KPN78578_02350; KPN_00243; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Target Names
nqrE
Target Protein Sequence
MAHYISLFVRAVFVENMALAFFLGMCTFLAVSKKVSTASGLGVAVTVVLGLAVPINNLVY NLVLRDGALVEGVDLSFLNFITFIGVIAALVQILEMILDKYFPALYNALGIFLPLIAVNC AIFGGVSFMVQRDYNFPESIVYGFGSGIGWMLAIVAMAGIREKMKYANVPAGLRGLGITF ITTGLMALGFMSFSGVQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two sequential reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Na(+)-translocating NADH-quinone reductase complex in Klebsiella pneumoniae?

Na(+)-translocating NADH-quinone reductase (Na(+)-NQR) in K. pneumoniae is a membrane-bound protein complex consisting of six subunits (NqrABCDEF) that functions as a primary sodium pump. The complex couples the energy released from oxidation of NADH with ubiquinone to the transport of sodium ions out of the cytoplasm with a 1e⁻/1Na⁺ stoichiometry. This process generates sodium motive force (SMF) that drives essential cellular processes including substrate transport and motility .

The complex contains various cofactors including:

  • Flavin adenine dinucleotide (FAD) in NqrF

  • [2Fe-2S] cluster in NqrF

  • Iron center embedded in NqrD and NqrE

  • Flavin mononucleotide (FMN) in NqrC

  • FMN and riboflavin in NqrB

  • Tightly bound ubiquinone-8 acting as a reductant for the ubiquinone substrate

What is the specific role of subunit E in the Na(+)-NQR complex?

Subunit E (NqrE) of the Na(+)-NQR complex works in conjunction with NqrD to house a deeply embedded iron center critical for electron transfer through the complex. The subunit is integral to the membrane-spanning portion of the complex and participates in creating the pathway for sodium ion translocation across the membrane. NqrE contributes to the structural stability of the complex and helps maintain the proper configuration of cofactors necessary for efficient electron transfer and ion transport .

How does the Na(+)-NQR complex differ between Klebsiella pneumoniae and other bacterial species?

Comparative studies of Na(+)-NQR between V. cholerae and K. pneumoniae have revealed subtle differences in cofactor binding and electron transfer rates that may reflect adaptations to their respective ecological niches.

What mechanisms contribute to reactive oxygen species (ROS) generation by the Na(+)-NQR complex in K. pneumoniae?

The Na(+)-NQR complex produces superoxide during substrate turnover through mechanisms involving its flavin cofactors. By analogy with complex I in mitochondria, several potential sites for ROS production exist in Na(+)-NQR:

  • Primary electron acceptor site: The initial electron transfer from NADH to FAD in NqrF may result in reduced FAD (FADH- or FADH₂) reacting with molecular oxygen to form superoxide .

  • Secondary flavin sites: The additional flavins in NqrB and NqrC could also contribute to superoxide formation, particularly when the electron transfer chain is partially reduced or inhibited .

  • Iron-sulfur cluster interactions: The [2Fe-2S] cluster in NqrF may facilitate electron leakage to oxygen under certain conditions .

The localization of FMN in NqrC to the periplasm, while other cofactors remain in the cytoplasm or transmembrane regions, suggests potential compartmentalization of ROS generation that may have significant implications for cellular redox homeostasis and oxidative stress responses .

How can recombinant expression systems be optimized for high-yield production of functional Na(+)-NQR subunit E?

Optimizing recombinant expression of Na(+)-NQR subunit E requires addressing several challenges associated with membrane protein expression:

Expression System Selection:

  • E. coli BL21(DE3) or C43(DE3) strains specifically designed for membrane protein expression

  • K. pneumoniae-based expression systems for native post-translational modifications

  • Cell-free expression systems for toxic or unstable proteins

Vector Design:

  • Use of inducible promoters (e.g., T7, arabinose) with tight regulation

  • Incorporation of purification tags (His, FLAG) at positions verified not to disrupt function

  • Inclusion of chaperone co-expression elements to facilitate proper folding

Culture Conditions:

  • Lower induction temperatures (16-25°C) to slow production and allow proper folding

  • Addition of specific membrane-mimicking environments

  • Supplementation with cofactor precursors (iron, riboflavin) to improve complex assembly

Purification Strategy:

  • Selective membrane solubilization using detergents like dodecyl maltoside

  • Density gradient centrifugation for isolation of intact complex

  • Affinity chromatography with on-column reconstitution of essential cofactors

Yields can be monitored using both protein quantification and activity assays that measure electron transfer rates or sodium transport capabilities.

What are the consequences of specific mutations in the NqrE subunit on energy transduction efficiency?

Mutations in the NqrE subunit can significantly impact the energy transduction efficiency of the Na(+)-NQR complex through several mechanisms:

Experimental data from site-directed mutagenesis studies can be correlated with structural information to develop a comprehensive understanding of structure-function relationships in this complex enzyme system.

What are the most effective protocols for isolating fully assembled and functional recombinant Na(+)-NQR complex?

Integrated Isolation Protocol:

  • Culture Preparation:

    • Grow transformed cells expressing all six Nqr subunits under microaerobic conditions

    • Supplement media with iron and riboflavin to ensure cofactor availability

    • Induce expression at OD₆₀₀ of 0.6-0.8 with appropriate inducer concentration

  • Membrane Isolation:

    • Harvest cells and disrupt by French press or sonication

    • Remove unbroken cells and debris by low-speed centrifugation (10,000 × g)

    • Collect membrane fraction by ultracentrifugation (150,000 × g, 1 hour)

  • Solubilization:

    • Resuspend membranes in buffer containing 1% dodecyl maltoside

    • Incubate with gentle agitation for 1 hour at 4°C

    • Remove insoluble material by centrifugation (100,000 × g, 30 minutes)

  • Affinity Purification:

    • Apply solubilized protein to appropriate affinity resin (often Ni-NTA for His-tagged constructs)

    • Wash extensively with decreasing detergent concentrations

    • Elute with competitive agent (imidazole for His-tag)

  • Complex Verification:

    • Size exclusion chromatography to confirm intact complex formation

    • Blue native PAGE to verify subunit composition

    • Activity assays measuring NADH:quinone oxidoreductase activity and Na⁺ transport

This protocol typically yields 1-3 mg of purified complex per liter of culture with >80% retention of native enzyme activity .

How can the enzymatic activity of Na(+)-NQR be accurately measured in experimental settings?

Comprehensive Activity Assay Panel:

  • NADH Oxidation Assay:

    • Monitor decrease in NADH absorbance at 340 nm

    • Reaction mixture contains purified enzyme, NADH, and ubiquinone

    • Calculate specific activity as μmol NADH oxidized/min/mg protein

  • Ubiquinone Reduction Assay:

    • Track formation of reduced ubiquinone at 275 nm

    • Requires anaerobic conditions to prevent auto-oxidation

    • Can be coupled with oxygen consumption measurements

  • Na⁺ Transport Assay:

    • Use fluorescent sodium indicators (e.g., SBFI) in proteoliposomes

    • Alternative: ²²Na⁺ uptake in inverted membrane vesicles

    • Quantify transport rate as μmol Na⁺/min/mg protein

  • ROS Generation Measurement:

    • Employ superoxide-specific probes (e.g., dihydroethidium)

    • Quantify using fluorescence spectroscopy or HPLC

    • Differentiate sites of ROS production using specific inhibitors

  • Electron Paramagnetic Resonance (EPR):

    • Detect formation of flavin radicals during catalysis

    • Monitor iron-sulfur cluster reduction status

    • Identify specific electron transfer intermediates

Control experiments should include enzyme inhibited with specific Na⁺-NQR inhibitors (e.g., korormicin, HQNO) to establish baseline measurements and confirm assay specificity .

What analytical techniques are most suitable for studying cofactor binding and electron transfer within the Na(+)-NQR complex?

Advanced Analytical Techniques:

  • Optical Spectroscopy:

    • UV-visible absorption spectroscopy (300-700 nm) to monitor flavin and iron center redox states

    • Circular dichroism to examine flavin binding environments

    • Stopped-flow spectroscopy for kinetic analysis of electron transfer events

  • Magnetic Resonance Techniques:

    • EPR spectroscopy for paramagnetic centers ([2Fe-2S] cluster, flavin semiquinones)

    • NMR for studying protein-cofactor interactions in small subunits or fragments

    • ENDOR (Electron Nuclear Double Resonance) for detailed electronic structure determination

  • Mass Spectrometry Applications:

    • Native MS to determine intact complex composition

    • HDX-MS (Hydrogen-Deuterium Exchange) to probe conformational changes during catalysis

    • Crosslinking-MS to map subunit interfaces and cofactor binding sites

  • Structural Analysis:

    • X-ray crystallography of individual subunits or subcomplexes

    • Cryo-EM for structure determination of the entire complex

    • SAXS (Small Angle X-ray Scattering) for low-resolution shape information

  • Computational Methods:

    • Molecular dynamics simulations of electron transfer pathways

    • Quantum mechanical calculations of cofactor energetics

    • Homology modeling for comparative analysis between bacterial species

Each technique provides complementary information, and integration of multiple approaches allows for comprehensive characterization of the complex electron transfer mechanisms within Na⁺-NQR .

How should researchers interpret conflicting data regarding the ubiquinone binding site in the Na(+)-NQR complex?

The localization of the ubiquinone binding site in Na(+)-NQR has been controversial, with different research groups reporting binding to either NqrB or NqrA subunits . When faced with such conflicting data, researchers should:

The most likely explanation may be that Q8 interacts with both subunits at different stages of the catalytic cycle, with the initial binding occurring at NqrA and subsequent electron transfer proceeding through NqrB .

What bioinformatic tools and databases are most valuable for analyzing Na(+)-NQR subunit E sequences and predicting functional properties?

Integrated Bioinformatic Analysis Pipeline:

  • Sequence Databases and Tools:

    • UniProt/Swiss-Prot for curated sequence information

    • NCBI Protein for comprehensive sequence repository

    • EnzyMine for specialized enzyme function and annotation data

    • BLAST and HMMER for homology searches across species

  • Structural Prediction Tools:

    • AlphaFold2/RoseTTAFold for 3D structure prediction

    • TMHMM/TOPCONS for transmembrane domain identification

    • SWISS-MODEL for homology modeling based on known structures

    • I-TASSER for integrated structure prediction

  • Functional Analysis Resources:

    • InterPro for domain and motif identification

    • ConSurf for evolutionary conservation analysis

    • EnzyMine for reaction feature mining and analysis

    • BRENDA for enzyme-specific biochemical data

  • Specialized Applications:

    • RaptorX-Contact for residue contact prediction

    • ProDy for protein dynamics analysis

    • COFACTOR for ligand binding site prediction

    • COACH for enzyme active site prediction

  • Integration Platforms:

    • Cytoscape for visualization of protein interaction networks

    • PyMOL/UCSF Chimera for structure visualization and analysis

    • R/Python with BioConductor/Biopython for custom analysis pipelines

EnzyMine represents a particularly valuable resource as it extends enzyme knowledge by incorporating reaction chemical feature strategies, displaying enzymes with comprehensive sequence and structural features, and providing chemical feature mining and analysis of enzymatic reactions .

How can researchers effectively design experiments to distinguish between direct and indirect effects of Na(+)-NQR inhibition in K. pneumoniae?

Experimental Design Framework:

  • Genetic Approach:

    StrategyImplementationControls
    Gene knockoutCRISPR-Cas9 deletion of nqrEComplementation with wild-type gene
    Conditional expressionInducible promoter controlling nqrEDose-response with inducer
    Point mutationsSite-directed mutagenesis of key residuesConservative vs. non-conservative changes
  • Pharmacological Approach:

    Inhibitor TypeApplicationValidation
    Specific Na(+)-NQR inhibitorsConcentration gradient treatmentCompetition assays
    IonophoresDissipation of Na+ gradientMeasurement of SMF
    Respiratory chain inhibitorsTargeted blockade at different complexesOxygen consumption analysis
  • Physiological Parameters to Monitor:

    ParameterDirect EffectIndirect Effect
    Membrane potentialImmediate changeGradual adaptation
    ATP levelsRapid decreaseCompensatory mechanisms
    Growth rateImmediate inhibitionDelayed response
    ROS productionSpecific sites affectedGeneral oxidative stress
    Gene expressionLimited responseGlobal reprogramming
  • Time-Resolved Analysis:

    • Short-term measurements (seconds to minutes) capture direct effects

    • Medium-term observations (hours) reveal compensatory responses

    • Long-term studies (days) identify adaptive mechanisms

  • Systems Biology Integration:

    • Metabolomics to track changes in intermediary metabolism

    • Transcriptomics to identify regulatory responses

    • Fluxomics to quantify alterations in metabolic pathway activities

By combining these approaches and carefully controlling experimental variables, researchers can build a comprehensive understanding of primary effects directly attributable to Na(+)-NQR function versus secondary consequences arising from altered cellular energetics .

How might Na(+)-NQR inhibition strategies be developed to combat K. pneumoniae infections?

The Na(+)-NQR complex represents a promising target for antimicrobial development against K. pneumoniae, particularly as it is absent in human cells. Several inhibition strategies can be explored:

  • Specific Inhibitor Development:

    • Structure-based design targeting unique pockets in Na(+)-NQR

    • Natural product derivatives based on known inhibitors (korormicin, HQNO)

    • Peptide inhibitors designed to disrupt subunit interfaces

  • Combination Therapy Approaches:

    • Na(+)-NQR inhibitors with conventional antibiotics

    • Dual targeting of energy metabolism (Na(+)-NQR + ATP synthase)

    • Inhibitors paired with ROS-generating compounds to exploit oxidative stress

  • Anti-virulence Strategy:

    • Exploiting the link between Na(+)-NQR function and biofilm formation

    • Targeting Na(+)-NQR to sensitize K. pneumoniae to host immune defenses

    • Modulating ROS production to disrupt bacterial stress responses

The ability of certain enzymes to combat biofilm-associated K. pneumoniae infections, as demonstrated with a bovine microbial enzyme that effectively prevents biofilm formation (IC₅₀ 2.50 μM) and degrades pre-formed biofilms (EC₅₀ 1.94 μM), provides a model for developing anti-virulence strategies that could work synergistically with Na(+)-NQR inhibitors .

What are the implications of ROS generation by Na(+)-NQR for bacterial physiology and virulence?

The generation of superoxide by Na(+)-NQR during substrate turnover has significant implications for bacterial physiology and virulence:

  • Oxidative Stress Regulation:

    • Basal ROS production may serve as a signaling mechanism

    • Excessive ROS production can damage cellular components

    • Bacterial defense systems (superoxide dismutase, catalase) must balance ROS levels

  • Metabolic Adaptations:

    • ROS production may influence metabolic pathway selection

    • Oxidative phosphorylation regulation under different oxygen tensions

    • Potential impact on fermentative versus respiratory metabolism

  • Virulence Factor Expression:

    • ROS-responsive transcription factors often regulate virulence genes

    • Biofilm formation may be modulated by redox signaling

    • Host-pathogen interactions could be influenced by bacterial ROS production

  • Antimicrobial Resistance:

    • Sublethal ROS exposure can induce stress responses that enhance resistance

    • Mutator phenotypes may emerge under oxidative stress

    • Antibiotic tolerance mechanisms often overlap with oxidative stress responses

The relationship between Na(+)-NQR, ROS production, and K. pneumoniae pathogenicity represents an important area for further investigation, particularly as it relates to biofilm formation and persistence during infection .

What emerging technologies could advance our understanding of Na(+)-NQR function and regulation?

Several cutting-edge technologies show promise for deepening our understanding of Na(+)-NQR:

  • Single-Molecule Techniques:

    • Single-molecule FRET to track conformational changes during catalysis

    • Optical tweezers to measure force generation during ion transport

    • Nanopore recording of individual enzyme complexes

  • Advanced Imaging Methods:

    • Super-resolution microscopy to visualize Na(+)-NQR distribution in bacterial membranes

    • Cryo-electron tomography of Na(+)-NQR in native membrane environments

    • Correlative light and electron microscopy for functional-structural relationships

  • Real-time Monitoring Systems:

    • Genetically encoded sensors for Na+ flux and membrane potential

    • In vivo detection of ROS production using targeted probes

    • Microfluidic devices for single-cell analysis of Na(+)-NQR activity

  • Synthetic Biology Approaches:

    • Minimal reconstituted systems with defined components

    • Engineered Na(+)-NQR variants with novel properties

    • Cell-free expression systems for rapid protein engineering

  • Computational Advancements:

    • Quantum mechanics/molecular mechanics simulations of electron transfer

    • Machine learning for predicting inhibitor binding and efficacy

    • Systems biology modeling of Na(+)-NQR's role in cellular energetics

Integration of these technologies with established biochemical and genetic approaches will provide unprecedented insights into the function, regulation, and potential therapeutic targeting of Na(+)-NQR in K. pneumoniae .

How might recombinant Na(+)-NQR systems be engineered for biotechnological applications?

Engineered Na(+)-NQR systems offer several promising biotechnological applications:

  • Bioenergy Applications:

    • Integration into microbial fuel cells for enhanced electron transfer

    • Coupling with bioelectrochemical systems for waste treatment

    • Development of Na+-gradient-powered biocatalytic processes

  • Biosensing Platforms:

    • Na+ sensors for environmental monitoring

    • ROS detection systems based on Na(+)-NQR activity

    • Drug screening platforms for antimicrobial discovery

  • Biocatalysis:

    • Coupling Na(+)-NQR electron transfer to valuable oxidoreduction reactions

    • Utilization of the sodium gradient to drive unfavorable reactions

    • Integration with other enzymatic systems for cascade reactions

  • Synthetic Biology Tools:

    • Modular energy transduction components for synthetic cells

    • Inducible gene expression systems responding to Na+ concentration

    • Engineered electron transfer pathways for novel metabolic routes

The experience with recombinant K. pneumoniae strains, such as the ∆dhaT mutant expressing puuC that successfully produces valuable chemicals like 3-HP and 1,3-PDO from glycerol, demonstrates the potential for engineering bacterial systems for biotechnological applications . Similar engineering approaches could be applied to Na(+)-NQR systems to harness their unique capabilities for practical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.