Recombinant Klebsiella pneumoniae subsp. pneumoniae NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; KPN78578_26340; KPN_02678; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Target Names
nuoA
Target Protein Sequence
MRMSTSTEVIAHHWAFAIFLIIAIGLCCLMLVGGWYLGGRARARSKNTPFESGIDSVGSA RLRLSAKFYLVAMFFVIFDVEALYLYAWSTSIRESGWVGFVEAAIFILVLLAGLVYLVRI GALDWTPARSRRTLVNPETDSPTNRHMQ
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, translocating four protons across the cytoplasmic membrane for every two electrons transferred, thus harnessing redox energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of nuoA in Klebsiella pneumoniae?

NuoA (also known as ND3 or Nqo7 in some species) is one of the membrane domain subunits of the NADH-quinone oxidoreductase complex in K. pneumoniae. This subunit is embedded in the membrane domain and contains multiple transmembrane segments. The protein features several conserved charged residues that are critical for its function, including lysine and glutamic acid residues that participate in proton translocation. Structurally, nuoA interacts directly with peripheral subunits and is essential for the assembly and function of the entire NDH-1 complex. Comparative studies with homologous proteins from E. coli suggest that K. pneumoniae nuoA likely contains conserved charged amino acid residues that are crucial for energy transduction and proton pumping activities .

What conserved domains and motifs are present in K. pneumoniae nuoA?

K. pneumoniae nuoA contains several highly conserved domains and motifs that are critical for its function:

  • Transmembrane domains: These hydrophobic regions anchor the protein within the membrane.

  • Conserved charged residues: Similar to E. coli nuoA, K. pneumoniae likely contains conserved charged residues including lysine, glutamic acid, and aspartic acid residues that participate in proton translocation.

  • Interaction interfaces: Regions that mediate interactions with other subunits of the complex.

Specifically, research on homologous proteins suggests the presence of conserved charged residues equivalent to K46, E51, D79, and E81 found in E. coli nuoA . These residues are likely involved in proton translocation and energy coupling mechanisms. Mutation studies in related organisms have shown that alterations in these conserved residues can significantly impact the NADH-Q reductase activity, suggesting their functional importance in the energy transduction process .

What are the optimal conditions for expressing recombinant K. pneumoniae nuoA in laboratory settings?

For optimal expression of recombinant K. pneumoniae nuoA, researchers should consider the following methodological approach:

Expression System Selection:

  • E. coli BL21(DE3) or similar strains are typically preferred due to their reduced protease activity and compatibility with membrane proteins.

  • For membrane proteins like nuoA, C41(DE3) or C43(DE3) strains may offer advantages as they're designed specifically for toxic membrane protein expression.

Vector Design:

  • Include a His-tag (preferably at the C-terminus) for purification purposes.

  • Consider using vectors with tightly regulated promoters like pET or pBAD systems.

  • Incorporate a protease cleavage site between the tag and protein for tag removal if needed for functional studies.

Culture Conditions:

  • Initial growth at 37°C to OD600 of 0.6-0.8.

  • Temperature reduction to 18-25°C before induction minimizes inclusion body formation.

  • Induce with 0.1-0.5 mM IPTG (for T7-based systems) or appropriate inducer.

  • Extended expression time (16-24 hours) at lower temperatures often yields better results for membrane proteins.

Media and Supplements:

  • Rich media (such as Terrific Broth) supplemented with glucose (0.5-1%) can enhance yield.

  • Addition of membrane stabilizers like glycerol (5-10%) may improve protein folding.

Researchers should validate expression using Western blotting with antibodies against the protein or the affinity tag. Optimization of these parameters through small-scale expression trials is recommended before scaling up to larger cultures .

What purification strategies are most effective for isolating functional nuoA protein while maintaining its native conformation?

Purifying membrane proteins like nuoA while preserving their native conformation requires specific strategies:

Membrane Fraction Isolation:

  • Harvest cells by centrifugation (6,000×g, 15 min, 4°C)

  • Resuspend in buffer containing 50 mM Tris-HCl pH 8.0, 100 mM NaCl, 5 mM MgCl2, with protease inhibitors

  • Disrupt cells via French press (15,000 psi) or sonication

  • Remove debris by centrifugation (10,000×g, 20 min, 4°C)

  • Ultracentrifuge supernatant (100,000×g, 1 h, 4°C) to collect membrane fraction

Detergent Solubilization:

  • Use mild detergents like n-dodecyl β-D-maltoside (DDM, 1%) or digitonin (1-2%)

  • Solubilize for 1-2 hours at 4°C with gentle rotation

  • Remove insoluble material by ultracentrifugation (100,000×g, 30 min, 4°C)

Affinity Purification:

  • Apply solubilized fraction to Ni-NTA or similar affinity resin

  • Wash with increasing imidazole concentrations (10-40 mM)

  • Elute with higher imidazole (250-300 mM)

  • Include detergent at concentrations above CMC throughout purification

Size Exclusion Chromatography:

  • Further purify via size exclusion chromatography using Superdex 200

  • Use buffer containing 20 mM HEPES pH 7.5, 150 mM NaCl, 5% glycerol, and detergent at 2-3× CMC

Stability Assessment:

  • Verify protein integrity via SDS-PAGE and Western blotting

  • Assess protein homogeneity by analytical size exclusion chromatography

  • Confirm functionality through activity assays measuring NADH-K3Fe(CN)6 reductase activity

Throughout purification, maintaining protein stability with appropriate detergents and buffer conditions is crucial. DDM (0.03-0.05%) or other mild detergents should be present in all buffers to prevent protein aggregation .

What mutational analysis approaches are most informative for studying nuoA function?

Systematic mutational analysis of nuoA provides critical insights into its function. Based on established protocols from related systems, the following approaches are recommended:

Site-Directed Mutagenesis Strategy:

  • Target conserved charged residues, particularly lysine, glutamic acid, and aspartic acid residues that are likely involved in proton translocation.

  • Design mutations that alter charge (e.g., K→A, E→Q, D→N) or eliminate charge completely (E→A, D→A).

  • Create both conservative (maintaining similar properties) and non-conservative mutations to distinguish between structural and functional roles.

  • Generate single mutations first, followed by double or multiple mutations to identify potential compensatory mechanisms.

Experimental Workflow:

  • Generate mutations using overlap extension PCR or QuikChange mutagenesis.

  • Verify mutations by DNA sequencing.

  • Express wild-type and mutant proteins under identical conditions.

  • Assess expression levels and membrane insertion by Western blotting.

  • Evaluate enzyme assembly by BN-PAGE (Blue Native PAGE).

  • Measure enzymatic activities, including:

    • NADH dehydrogenase activity using artificial electron acceptors (K3Fe(CN)6)

    • NADH-Q reductase activity using physiological electron acceptors

    • Proton pumping activity using pH-sensitive fluorescent dyes

Analysis of Results:
Compare mutants to wild-type protein across multiple parameters:

  • Expression level and stability

  • Complex assembly

  • NADH oxidation rates

  • Quinone reduction rates

  • Proton translocation efficiency

Based on studies in related systems, mutations in key residues can reveal distinct phenotypes. For example, in E. coli, mutations in conserved charged residues (E51A, D79A, D79N, E81A, and E81Q) suppressed NADH-Q reductase activity to varying degrees (30-90% inhibition) while having minimal effects on NADH-K3Fe(CN)6 reductase activity, indicating specific roles in quinone reduction or proton translocation rather than NADH oxidation .

How does K. pneumoniae nuoA compare structurally and functionally to homologous proteins in other bacterial species?

Comparative analysis reveals significant conservation of nuoA across bacterial species, with important implications for research approaches:

Structural Conservation:
The nuoA subunit (also known as ND3 in mitochondria or Nqo7 in some bacteria) maintains high structural similarity across species. In both E. coli and K. pneumoniae, nuoA functions as an integral membrane component of the NADH-quinone oxidoreductase complex (NDH-1/Complex I). Sequence alignment analysis typically shows:

  • Core transmembrane domains with >70% conservation

  • Highly conserved charged residues in similar positions

  • Consistent protein size (~120-140 amino acids)

Specifically, E. coli nuoA contains key functional residues including K46, E51, D79, and E81 that are likely conserved in K. pneumoniae as well . These residues participate in proton translocation and energy coupling.

Functional Comparison:
Despite structural conservation, functional variations exist:

SpeciesKey FeaturesFunctional Characteristics
K. pneumoniaeIntegral membrane subunit in NDH-1Involved in proton translocation; specific activity patterns under investigation
E. coliContains 3-4 transmembrane segmentsMutations in charged residues (E51A, D79A/N, E81A/Q) suppress NADH-Q reductase activity (30-90%)
P. denitrificansDirect interaction with peripheral subunits demonstratedCross-linking studies confirm interaction with Nqo6 (PSST) and Nqo4 (49 kDa)

Research Implications:
The high conservation suggests that findings from other bacterial species can inform K. pneumoniae nuoA research. For example:

  • Mutation studies on E. coli nuoA revealing the importance of conserved charged residues can guide similar studies in K. pneumoniae.

  • Cross-linking studies from P. denitrificans demonstrating interactions between nuoA and peripheral subunits suggest similar interactions might exist in K. pneumoniae.

  • The assembly process of NDH-1 observed in other species likely applies to K. pneumoniae as well .

What specific amino acid residues in K. pneumoniae nuoA are critical for proton translocation?

Based on homology with well-studied bacterial species and the conservation of key functional domains, several amino acid residues in K. pneumoniae nuoA are predicted to be critical for proton translocation:

Key Conserved Residues:
By extrapolating from E. coli studies, the following residues are likely essential for proton translocation in K. pneumoniae nuoA:

  • Lysine Residues: The lysine equivalent to K46 in E. coli is likely involved in the proton pathway. In E. coli, mutation K46A showed minimal impact on NADH-Q reductase activity, suggesting a structural rather than direct catalytic role .

  • Glutamic Acid Residues: Residues homologous to E51 and E81 in E. coli are probably critical. E51A mutation in E. coli suppressed activity to 30%, while E81A and E81Q mutations reduced activity to 40% and 50%, respectively .

  • Aspartic Acid Residues: The equivalent to D79 in E. coli is particularly important. In E. coli, D79A and D79N mutations inhibited activity by 90% and 40%, respectively, indicating a crucial role in proton translocation .

Functional Significance:
These charged residues likely form a proton translocation pathway through:

  • Proton acceptance and donation

  • Formation of salt bridges with residues in other subunits

  • Conformational changes coupled to the catalytic cycle

Experimental Verification Approach:
To confirm the roles of these residues specifically in K. pneumoniae:

  • Perform site-directed mutagenesis targeting predicted key residues

  • Measure proton pumping efficiency using pH-sensitive fluorescent dyes

  • Assess impact on NADH oxidation and quinone reduction activities separately

  • Conduct pH-dependent activity assays to further characterize proton coupling

Studies in E. coli demonstrated that mutations in these conserved charged residues specifically affected NADH-Q reductase activity while having minimal impact on NADH-K3Fe(CN)6 reductase activity, indicating their role in coupling electron transfer to proton translocation rather than in the primary electron transfer pathway .

Could nuoA be a potential target for novel antimicrobial development against MDR K. pneumoniae strains?

The potential of nuoA as a novel antimicrobial target presents an intriguing research direction, particularly given the urgent need for new approaches against multidrug-resistant (MDR) K. pneumoniae:

Target Validation Criteria:
For nuoA to be considered a viable antimicrobial target, it should meet several criteria:

  • Essentiality: Evidence suggests that disruption of the NDH-1 complex significantly impacts bacterial viability and virulence. While bacteria may possess alternative respiratory pathways, the energy efficiency of NDH-1 makes it particularly important under the resource-limited conditions encountered during infection.

  • Conservation and Specificity: NuoA shows sufficient conservation across bacterial species to allow broad-spectrum activity, but has distinct differences from mammalian homologs that could enable selective targeting.

  • Druggability: The membrane location of nuoA presents both challenges and opportunities. While membrane proteins can be difficult to target, their accessibility from the periplasmic space may facilitate drug delivery.

Potential Targeting Strategies:
Several approaches could be employed to target nuoA:

  • Small molecule inhibitors: Designed to interfere with:

    • Conserved charged residues essential for proton translocation

    • Protein-protein interactions between nuoA and other subunits

    • Conformational changes required for function

  • Peptide inhibitors: Designed to mimic interaction interfaces and disrupt complex assembly

  • Combined approaches: Targeting nuoA in combination with other antimicrobials to enhance efficacy and reduce resistance development

Advantages as an Antimicrobial Target:
NuoA presents several advantages as a target against MDR K. pneumoniae:

  • Novel target: No current antibiotics specifically target the NDH-1 complex, potentially circumventing existing resistance mechanisms

  • Essential function: Energy production is critical for bacterial survival and virulence

  • Relevance to resistance: The energy provided by NDH-1 supports various resistance mechanisms, including efflux pump operation, which are critical for carbapenem-resistant K. pneumoniae (CRKP)

The emergence of carbapenem-resistant K. pneumoniae, particularly those harboring NDM-1 and other carbapenemases, represents a significant clinical challenge . By targeting nuoA and disrupting energy production, it may be possible to develop therapies effective against these "superbugs" that currently have limited treatment options. Additionally, such inhibitors might function as antivirulence agents even at sub-lethal concentrations by reducing the energy available for virulence factor production.

What experimental models are most appropriate for studying nuoA function in the context of K. pneumoniae infections?

Studying nuoA function in infection contexts requires carefully selected experimental models that balance physiological relevance with experimental tractability:

In Vitro Models:

  • Cell Culture Infection Models:

    • Human lung epithelial cells (A549) for pneumonia models

    • Human bladder epithelial cells (T24) for urinary tract infection models

    • Macrophage cell lines (THP-1, RAW264.7) to study bacterial survival within phagocytes

    Methodology: Infect cells with wild-type and nuoA-mutant K. pneumoniae strains at various MOIs (1:1 to 100:1) and assess:

    • Bacterial adhesion and invasion rates

    • Intracellular survival

    • Host cell inflammatory responses

    • Cytotoxicity

  • Biofilm Formation Assays:

    • Static biofilm formation in 96-well plates

    • Flow cell systems for dynamic biofilm development

    Measurements: Quantify biofilm formation using crystal violet staining or confocal microscopy to assess the impact of nuoA mutations on biofilm development, a key virulence trait of K. pneumoniae.

Ex Vivo Models:

  • Human Lung Tissue Explants:
    Particularly relevant for studying respiratory infections, allowing assessment of bacterial interactions with complex tissue architecture.

  • Whole Blood Assays:
    To investigate survival in bloodstream and interactions with immune components under physiologically relevant conditions.

In Vivo Models:

  • Mouse Models:

    • Intranasal infection for pneumonia

    • Transurethral infection for UTIs

    • Intraperitoneal infection for systemic disease

    The collaborative cross (CC) mice approach has been specifically used to identify host candidate genes involved in K. pneumoniae infection susceptibility, including Ctnnal1, Actl7a, Actl7b, and Bag4 .

  • Galleria mellonella (Wax Moth) Larvae:
    A simpler model that can provide preliminary data on virulence with fewer ethical considerations.

Specialized Techniques for nuoA Functional Analysis:

  • In vivo expression technology (IVET):
    To monitor nuoA expression during different stages of infection.

  • Competitive index assays:
    Co-infection with wild-type and nuoA-mutant strains to directly assess fitness contribution.

  • Real-time monitoring:
    Using bioluminescent reporters linked to nuoA expression to track activity during infection progression.

Considerations for Model Selection:
When studying K. pneumoniae, it's important to consider host factors that influence susceptibility. Research has shown that elderly individuals have higher mortality rates (approximately 30%) from K. pneumoniae infections . Similarly, premature newborns and individuals with diabetes, malignancy, liver disease, or chronic obstructive pulmonary disease show increased susceptibility . Experimental models should account for these conditions when possible, through the use of diabetic mouse models or aged animals to better reflect clinical reality.

What advanced structural biology approaches can provide insights into nuoA conformation and dynamics?

Understanding the three-dimensional structure and dynamic behavior of nuoA requires specialized approaches suitable for membrane proteins:

Cryo-Electron Microscopy (Cryo-EM):
Cryo-EM has revolutionized membrane protein structural biology and offers particular advantages for studying nuoA:

  • Sample Preparation Protocol:

    • Purify intact NDH-1 complex with nuoA in amphipol A8-35 or nanodiscs

    • Apply 3-4 μl to glow-discharged holey carbon grids

    • Blot for 3-4 seconds at 100% humidity, 4°C

    • Plunge-freeze in liquid ethane using Vitrobot or similar device

  • Data Collection Parameters:

    • 300 kV microscope with direct electron detector

    • Dose fractionation (40-50 frames, total dose ~50 e-/Ų)

    • Defocus range: -0.8 to -2.5 μm

    • Pixel size: 0.8-1.0 Å

  • Analysis Workflow:

    • Motion correction using MotionCor2

    • CTF estimation with CTFFIND4

    • Particle picking and 2D classification

    • 3D classification and refinement

    • Focused refinement on membrane domain containing nuoA

Hydrogen/Deuterium Exchange Mass Spectrometry (HDX-MS):
This technique provides valuable information about protein dynamics and solvent accessibility:

  • Experimental Approach:

    • Exchange periods ranging from 10 seconds to 24 hours

    • Quench at pH 2.5, 0°C

    • Pepsin digestion and LC-MS/MS analysis

    • Comparative analysis between wild-type and mutant proteins

  • Advantages for nuoA Research:

    • Can detect conformational changes upon substrate binding

    • Identifies regions with altered dynamics in mutant variants

    • Provides information about protein-protein interaction surfaces

Molecular Dynamics Simulations:
Computational approaches provide atomic-level insights into nuoA function:

  • Simulation Protocol:

    • Embed protein in POPC bilayer using CHARMM-GUI

    • Solvate system with explicit water and physiological ion concentration

    • Energy minimization followed by equilibration

    • Production runs of 500 ns to microseconds

  • Analysis Methods:

    • Track proton transfer events through conserved charged residues

    • Monitor water dynamics in putative proton channels

    • Calculate free energy profiles for ion/proton movement

Site-Directed Spin Labeling and EPR Spectroscopy:
This approach provides information about distances and dynamics:

  • Methodology:

    • Introduce cysteine residues at strategic positions by site-directed mutagenesis

    • Label with MTSL or similar spin labels

    • Perform double electron-electron resonance (DEER) measurements

    • Derive distance constraints between labeled sites

These advanced techniques, when combined, can provide unprecedented insights into how nuoA participates in proton translocation and energy coupling within the NADH-quinone oxidoreductase complex of K. pneumoniae.

How can systems biology approaches be applied to understand the broader metabolic impact of nuoA mutations?

Systems biology offers powerful frameworks to contextualize nuoA function within K. pneumoniae's broader metabolic network:

Multi-omics Integration Strategy:

Network Analysis Approaches:

  • Genome-Scale Metabolic Modeling:

    • Construct or adapt existing K. pneumoniae metabolic models

    • Simulate growth and metabolic phenotypes under various conditions

    • Predict synthetic lethality partners for nuoA

    Software tools: Use COBRA Toolbox or similar platforms for flux balance analysis.

  • Protein-Protein Interaction Networks:

    • Map interactions between respiratory complex components

    • Identify regulatory relationships affecting energy metabolism

    • Construct dynamic models of respiratory chain assembly

Experimental Validation:

  • Phenotypic Microarrays:

    • Use Biolog plates to assess growth on hundreds of substrates

    • Compare metabolic capabilities of wild-type and nuoA mutants

    • Identify condition-specific growth defects

  • Real-time Bioenergetic Measurements:

    • Oxygen consumption rate (OCR) using Seahorse XF analyzer

    • Membrane potential monitoring with fluorescent dyes

    • ATP production rate measurements

  • In vivo Metabolic Sensors:

    • Deploy genetically encoded biosensors for NADH/NAD+ ratio

    • Monitor ATP levels using luciferase-based reporters

    • Track pH gradients with pHluorin or similar sensors

Integration Framework:
Develop computational methods to integrate these datasets into a unified model of how nuoA impacts cellular energetics and metabolism. This approach can reveal both direct effects of nuoA mutation on respiratory function and downstream adaptations that may contribute to phenotypes like antibiotic resistance or virulence.

The systems biology approach is particularly valuable for understanding K. pneumoniae pathogenicity, as energy metabolism supports numerous virulence mechanisms and stress responses that contribute to the organism's success as a pathogen .

What are the most promising directions for future research on K. pneumoniae nuoA?

Future research on K. pneumoniae nuoA presents several promising avenues that could significantly advance our understanding of bacterial energetics and potentially lead to new therapeutic strategies:

Structural and Mechanistic Studies:

  • High-Resolution Structure Determination:
    Obtaining atomic-resolution structures of K. pneumoniae nuoA within the intact NDH-1 complex would provide crucial insights into species-specific features. While challenging, advances in cryo-EM technology make this increasingly feasible.

  • Proton Translocation Mechanisms:
    Detailed characterization of the proton pathway through nuoA using a combination of site-directed mutagenesis, computational modeling, and real-time proton transport assays could resolve long-standing questions about energy coupling mechanisms.

  • Conformational Dynamics:
    Investigating the conformational changes that occur during the catalytic cycle using techniques like hydrogen-deuterium exchange mass spectrometry or single-molecule FRET could reveal dynamic aspects of nuoA function.

Clinical and Translational Research:

  • Hypervirulent Strain Characterization:
    Comparing nuoA sequence, expression, and function between classical and hypervirulent K. pneumoniae strains could reveal adaptations that contribute to enhanced virulence. The emergence of hypervirulent carbapenem-resistant strains like ST11 CR-HvKp represents a particular clinical challenge .

  • Inhibitor Development:
    Designing and screening small molecule inhibitors that specifically target nuoA could lead to novel antimicrobials effective against multidrug-resistant strains. Focus areas include:

    • Blocking interaction interfaces between nuoA and other subunits

    • Disrupting proton translocation pathways

    • Interfering with conformational changes required for function

  • Host-Pathogen Interactions:
    Investigating how host factors influence respiratory chain function during infection could identify new therapeutic targets. This is particularly relevant given the identified host susceptibility genes Ctnnal1, Actl7a, Actl7b, and Bag4 .

Comparative and Evolutionary Studies:

  • Cross-Species Comparison:
    Comparative analysis of nuoA function across pathogenic and non-pathogenic bacteria could reveal adaptations specific to pathogenic lifestyles.

  • Evolutionary Trajectories:
    Tracking nuoA sequence changes across clinical isolates collected over time could provide insights into selective pressures and functional adaptation during infection and treatment.

Technological Innovations:

  • Single-Cell Energetics:
    Developing methods to monitor respiratory chain function at the single-cell level during infection could reveal population heterogeneity and its contribution to persistence and resistance.

  • In vivo Imaging:
    Creating tools to visualize respiratory complex assembly and localization during different growth phases and infection stages would advance our understanding of dynamic regulation.

  • CRISPR-Based Tools:
    Applying CRISPR interference or activation to modulate nuoA expression with temporal precision could help dissect its role in adaptation to changing environments.

These research directions, pursued individually or in combination, would significantly advance our understanding of K. pneumoniae nuoA and potentially lead to new strategies for combating this increasingly problematic pathogen, particularly as carbapenem-resistant and hypervirulent strains continue to emerge worldwide .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.