Recombinant Klebsiella pneumoniae subsp. pneumoniae NADH-quinone oxidoreductase subunit K (nuoK)

What is NADH-quinone oxidoreductase subunit K (nuoK) in Klebsiella pneumoniae?

NADH-quinone oxidoreductase subunit K (nuoK) is a membrane protein component of NADH dehydrogenase I (NDH-1) in Klebsiella pneumoniae subsp. pneumoniae. It functions as part of the respiratory chain complex I, which is responsible for electron transport during cellular respiration. In the Uniprot database, this protein is identified by accession number A6TBW5. The protein consists of 100 amino acids with the sequence "MIPLTHGLILAAILVLGLTGLVIRRNLLFMLISLEIMINÁAALAFVVAGSYWGQADGQIMYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSELRG." Its systematic name is EC 1.6.99.5, which classifies it as an oxidoreductase acting on NADH with various acceptors .

How is nuoK conserved across bacterial species?

While the search results don't provide direct comparison data for nuoK specifically, we can infer conservation patterns based on similar research methodologies. Using bioinformatic approaches similar to those used for other bacterial proteins, researchers can determine the conservation of nuoK across species. For instance, when studying other proteins within the Paramyxovirus family, researchers performed sequence alignment comparison using the NCBI blast tool and MEGA X with the clustalW algorithm . This approach revealed conservation levels ranging from 97.8% to 100% identity for some proteins. For nuoK research, a similar methodological approach would involve:

• Collecting nuoK sequences from various bacterial species

• Using multiple sequence alignment tools (MEGA X, Clustal Omega)

• Performing phylogenetic analysis to determine evolutionary relationships

• Identifying conserved domains and functional motifs

What expression systems are suitable for producing recombinant nuoK?

For the expression of recombinant nuoK, researchers typically employ bacterial expression systems, particularly E. coli, as evidenced by similar recombinant protein production methods. The methodology involves:

• Cloning the ORF of the nuoK gene into an expression vector such as pET-SUMO

• Transforming the recombinant plasmid into competent E. coli cells

• Growing bacterial cultures in LB medium supplemented with appropriate antibiotics

• Inducing protein expression with IPTG when the culture reaches 0.5-0.6 OD

• Harvesting cells and purifying the target protein

The pET-SUMO expression system is particularly advantageous for membrane proteins like nuoK because the SUMO tag can enhance solubility and facilitate purification. For optimal expression, researchers should consider using E. coli strains designed for membrane protein expression, such as C41(DE3) or C43(DE3).

How can nuoK contribute to vaccine development against Klebsiella pneumoniae?

Based on these findings, researchers investigating nuoK as a potential vaccine candidate should consider:

• Evaluating nuoK conservation across K. pneumoniae strains to assess breadth of coverage

• Testing recombinant nuoK's ability to elicit antigen-specific antibodies (IgG, IgG1, IgG2a)

• Measuring T-cell responses, particularly IFN-γ-, IL4-, and IL17A-mediated immune responses

• Developing challenge models to evaluate protective efficacy

• Considering nuoK as part of a multivalent approach rather than a standalone antigen

The protective immune response evaluation should follow protocols similar to those used for KOMPs, where mice were vaccinated and then challenged with K. pneumoniae to assess survival rates and immune response markers .

What challenges exist in studying membrane proteins like nuoK?

Membrane proteins such as nuoK present several experimental challenges:

Researchers must carefully optimize each step of expression and purification to maintain the native structure and function of nuoK.

How might nuoK contribute to antibiotic resistance in Klebsiella pneumoniae?

K. pneumoniae can develop into "superbugs" that are highly resistant to antibiotics . While the search results don't directly link nuoK to antibiotic resistance, as part of the respiratory chain, nuoK could potentially contribute to:

• Energy metabolism adaptations that support survival under antibiotic stress

• Membrane potential maintenance that affects the efficacy of certain antibiotics

• Electron transport chain modifications that alter bacterial physiology during infection

Research approaches to investigate this relationship should include:

• Generating nuoK knockout strains and assessing changes in antibiotic susceptibility

• Performing transcriptomic and proteomic analyses to identify regulatory networks involving nuoK

• Using site-directed mutagenesis to identify critical residues that affect both enzyme function and antibiotic resistance

• Assessing nuoK expression levels in clinical isolates with varying antibiotic resistance profiles

What techniques can be used to verify the structure and function of recombinant nuoK?

Verifying both the structure and function of recombinant nuoK requires multiple complementary approaches:

Structural Verification:

• Computational Modeling: Similar to approaches used for other proteins, molecular modeling can be performed via the SWISS-MODEL server using appropriate templates. The predicted structures can be visualized and analyzed using programs like PyMOL .

• Circular Dichroism (CD): To assess secondary structure content and proper folding

• Limited Proteolysis: To verify domain organization and structural integrity

• Mass Spectrometry: For accurate mass determination and potential post-translational modifications

Functional Verification:

• NADH Oxidation Assays: Measuring the rate of NADH oxidation in the presence of suitable electron acceptors

• Reconstitution Studies: Incorporating purified nuoK into liposomes or nanodiscs to measure activity

• Membrane Potential Measurements: Using fluorescent dyes to assess the protein's contribution to membrane potential

• Complementation Studies: Testing whether recombinant nuoK can restore function in nuoK-deficient bacterial strains

How can protein-protein interactions involving nuoK be studied?

Understanding protein-protein interactions is crucial for elucidating nuoK's role within the respiratory complex. Recommended methodological approaches include:

• Co-immunoprecipitation (Co-IP): Using antibodies against nuoK or interacting partners to pull down protein complexes

• Bacterial Two-Hybrid System: Adapted for membrane proteins to detect direct interactions

• Crosslinking Mass Spectrometry: Identifying interaction interfaces through chemical crosslinking followed by MS analysis

• Förster Resonance Energy Transfer (FRET): For studying interactions in living cells

• Surface Plasmon Resonance (SPR): Measuring binding kinetics between nuoK and potential partners

The experimental design should consider the hydrophobic nature of nuoK and use appropriate detergents or membrane mimetics to maintain protein stability throughout the analyses.

What role might nuoK play in Klebsiella pneumoniae pathogenesis?

K. pneumoniae is known to cause both hospital-acquired and community-acquired infections . While nuoK's specific role in pathogenesis isn't directly addressed in the search results, respiratory chain components often contribute to bacterial virulence. Researchers should consider:

• Evaluating nuoK expression during different stages of infection

• Creating nuoK mutants and testing them in infection models

• Assessing the protein's contribution to survival under host-imposed stresses

• Investigating whether nuoK affects the expression of known virulence factors

Research should focus on how energy metabolism, specifically through nuoK function, supports bacterial adaptation to host environments and contributes to virulence.

How can systems biology approaches enhance nuoK research?

• Multi-omics Integration: Combining transcriptomics, proteomics, and metabolomics to understand how nuoK responds to environmental changes

• Network Analysis: Identifying regulatory networks that control nuoK expression and activity

• Flux Balance Analysis: Modeling how changes in nuoK activity affect metabolic fluxes

• Comparative Genomics: Analyzing nuoK conservation and evolution across bacterial species

These approaches would help place nuoK within the broader context of bacterial metabolism and pathogenesis, potentially identifying novel therapeutic targets.