Recombinant Klebsiella pneumoniae subsp. pneumoniae Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

The L-Ara4N Modification Pathway

The addition of 4-amino-4-deoxy-L-arabinose (L-Ara4N) to lipid A involves a complex biochemical pathway in which ArnE plays a critical role. This modification pathway represents a sophisticated mechanism that Gram-negative bacteria have evolved to resist cationic antimicrobial agents .

The pathway begins with UDP-glucose, which is converted to UDP-glucuronic acid . The C-terminal domain of ArnA then catalyzes the oxidative decarboxylation of UDP-glucuronic acid to generate UDP-4-ketopentose . This intermediate is subsequently transaminated by ArnB using glutamic acid as the amine donor to produce UDP-β-L-Ara4N, which is then N-formylated by the N-terminal domain of ArnA .

The next steps in the pathway involve the transfer of the N-formylated L-Ara4N moiety to undecaprenyl phosphate by ArnC, followed by deformylation by ArnD to generate undecaprenyl phosphate-α-L-Ara4N . This is where ArnE and its partner ArnF become critical - they form a heterodimeric flippase that translocates undecaprenyl phosphate-α-L-Ara4N from the cytoplasmic side to the periplasmic side of the inner membrane . Once on the periplasmic side, the ArnT transferase catalyzes the addition of the L-Ara4N moiety to lipid A .

Research has demonstrated that mutations in the genes encoding these proteins, including arnE, can lead to impaired L-Ara4N modification of lipid A and consequently increased sensitivity to colistin and other cationic antimicrobial peptides . Specifically, studies have shown that when the flippase function is disrupted, L-Ara4N cannot be added to lipid A even though its lipid-linked donor is synthesized normally on the cytoplasmic side of the membrane .

Table 2: Enzymes of the L-Ara4N Modification Pathway

EnzymeFormer NameFunction in L-Ara4N Pathway
PmrE-Converts UDP-glucose to UDP-glucuronic acid
ArnA (C-terminal)-Oxidative decarboxylation to form UDP-4-ketopentose
ArnB-Transamination to generate UDP-β-L-Ara4N
ArnA (N-terminal)-N-formylation of UDP-β-L-Ara4N
ArnC-Transfers L-Ara4N to undecaprenyl phosphate
ArnD-Deformylates undecaprenyl phosphate-N-formyl-L-Ara4N
ArnEPmrMFlippase subunit for undecaprenyl phosphate-L-Ara4N translocation
ArnFPmrLFlippase subunit partnering with ArnE
ArnT-Transfers L-Ara4N from undecaprenyl phosphate-L-Ara4N to lipid A

Role in Antimicrobial Resistance

The modification of lipid A with L-Ara4N represents a key mechanism of resistance to polymyxins (including colistin) and other cationic antimicrobial peptides in Klebsiella pneumoniae and other Gram-negative bacteria . As a critical component of the flippase that facilitates this modification, ArnE plays an essential role in this resistance mechanism.

Lipid A, the hydrophobic anchor of lipopolysaccharide (LPS), typically carries negative charges due to phosphate groups. Cationic antimicrobial peptides and polymyxins bind to these negatively charged groups, disrupting membrane integrity and leading to bacterial cell death . The addition of L-Ara4N to lipid A neutralizes some of this negative charge, reducing the affinity of these antimicrobials for the bacterial outer membrane and thereby conferring resistance .

Research has demonstrated that disruption of the arnE gene or other genes in the L-Ara4N modification pathway leads to increased susceptibility to colistin . For example, a study on a K. pneumoniae DedA family membrane protein (DkcA) found that mutation of dkcA resulted in a reduction of colistin minimal inhibitory concentration similar to that observed with an ΔarnT strain . Mass spectrometry analysis revealed that lipid A from the ΔdkcA mutant showed a near absence of L-Ara4N modifications, suggesting that multiple protein systems may coordinate to ensure proper modification of lipid A .

The emergence of colistin-resistant K. pneumoniae is particularly concerning because colistin is often considered a last-resort antibiotic for infections caused by multidrug-resistant Gram-negative bacteria . As K. pneumoniae continues to develop resistance to multiple antibiotics, understanding the molecular mechanisms of this resistance, including the role of ArnE, becomes increasingly important for public health .

Table 3: Impact of Gene Mutations on Colistin Resistance

GeneProtein FunctionEffect of Mutation on Lipid AImpact on Colistin Resistance
arnEFlippase subunitReduced L-Ara4N modificationIncreased susceptibility
arnFFlippase subunitReduced L-Ara4N modificationIncreased susceptibility
arnTL-Ara4N transferaseNo L-Ara4N modificationIncreased susceptibility
dkcADedA family membrane proteinReduced L-Ara4N modificationIncreased susceptibility

Recombinant Production and Research Applications

The recombinant production of K. pneumoniae ArnE has facilitated various research applications aimed at understanding its function and potential as a therapeutic target. Several expression systems have been employed for the production of recombinant ArnE, including Escherichia coli, yeast, baculovirus, and mammalian cell expression systems .

The availability of recombinant ArnE has enabled various in vitro studies, including:

  1. Biochemical characterization of flippase activity and substrate specificity

  2. Protein-protein interaction studies to understand the formation and functioning of the ArnE/ArnF heterodimer

  3. Screening of potential inhibitors that could interfere with flippase function and restore susceptibility to colistin

  4. Production of antibodies for detection and localization studies

  5. Structural analyses to determine protein conformation and critical functional domains

Commercial sources offer recombinant K. pneumoniae ArnE with varying specifications, typically with high purity (≥85%) suitable for research applications . These preparations often include partial or complete protein sequences optimized for solubility and stability.

Table 4: Commercial Sources and Specifications of Recombinant ArnE

SupplierProduct TypePurityExpression SystemApplication
CUSABIO TECHNOLOGY LLCRecombinant ProteinNot specifiedNot specifiedResearch use only
Various commercial vendorsRecombinant Protein≥85%VariousResearch use only

The recombinant production of K. pneumoniae ArnE represents an important resource for advancing our understanding of antimicrobial resistance mechanisms and for developing potential therapeutic interventions targeting this crucial protein.

Current Research and Future Directions

Recent research has significantly advanced our understanding of ArnE and its role in antimicrobial resistance, while also highlighting areas requiring further investigation. A 2021 study identified connections between a K. pneumoniae DedA family membrane protein (DkcA) and colistin resistance, finding that mutation of dkcA resulted in reduced L-Ara4N modification of lipid A and increased colistin susceptibility . This suggests potential interactions between various membrane proteins in facilitating lipid A modification.

A comprehensive genomic study of clinical K. pneumoniae isolates in Norway from 2001-2015 tracked the emergence and dissemination of extended-spectrum β-lactamase (ESBL)-producing strains . While not directly focused on ArnE, such population-level studies provide important context for understanding how various resistance mechanisms evolve and spread in clinical settings.

In 2024, researchers employed machine learning approaches to identify virulence factors in K. pneumoniae, re-annotating protein functions and analyzing their groupings . They identified 39 virulence factors and 10 potential drug targets, contributing to a more comprehensive understanding of K. pneumoniae pathogenesis and potential therapeutic interventions .

Future research directions that could advance our understanding of ArnE include:

  1. Determination of the three-dimensional structure of the ArnE/ArnF complex using advanced techniques such as cryo-electron microscopy

  2. Investigation of regulatory mechanisms controlling arnE expression and how environmental factors influence the L-Ara4N modification pathway

  3. Development and screening of specific inhibitors targeting the ArnE/ArnF flippase to restore colistin sensitivity

  4. Exploration of potential synergistic effects between ArnE inhibition and other antimicrobial strategies

  5. Examination of the role of ArnE in bacterial virulence and host-pathogen interactions

Table 5: Future Research Priorities for K. pneumoniae ArnE

Research DirectionPotential ImpactTechnical Approaches
Structural characterizationEnable structure-based drug designCryo-EM, X-ray crystallography, NMR
Regulatory mechanismsIdentify additional targets for interventionTranscriptomics, reporter assays, protein-DNA interaction studies
Inhibitor developmentRestore effectiveness of existing antibioticsHigh-throughput screening, rational drug design, fragment-based approaches
Synergistic strategiesOvercome resistance through multi-target approachesCombination studies, interaction networks
Virulence connectionsLink resistance and pathogenesis mechanismsInfection models, virulence assays

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
arnE; KPN78578_38050; KPN_03842; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-112
Protein Length
full length protein
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Target Names
arnE
Target Protein Sequence
MSVWICLVCASLLSCAGQLCQKQATRPSRRGRRSRHILFWLGMALLCLGCGMLLWLSVLQ SIPVSIAYPMLSLNFVWVTLAGWGIWHEPVARRHWLGVGLIVVGIVILGTSV
Uniprot No.

Target Background

Function
This protein translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) across the inner membrane, from the cytoplasmic to the periplasmic side.
Database Links
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ArnE protein and what is its primary function in Klebsiella pneumoniae?

ArnE functions as a subunit of the 4-amino-4-deoxy-L-arabinose (Ara4N)-phosphoundecaprenol flippase complex in Klebsiella pneumoniae. This membrane protein works in conjunction with ArnF to form a complete flippase that translocates Ara4N-modified lipids across the cytoplasmic membrane. The protein is part of the arnBCADTEF operon, which encodes enzymes responsible for the modification of lipid A with Ara4N. This modification alters the bacterial outer membrane charge, reducing the binding affinity of cationic antimicrobial peptides and certain antibiotics, thereby contributing to antimicrobial resistance in Klebsiella pneumoniae . The protein's structure suggests it contains multiple transmembrane domains typical of membrane transport proteins, allowing it to facilitate the flipping mechanism required for lipopolysaccharide modification.

How does the ArnE subunit differ between multidrug-resistant (MDR) and hypervirulent K. pneumoniae strains?

MDR K. pneumoniae strains often show greater diversity in membrane modification proteins, including ArnE variants, compared to hypervirulent strains. This is consistent with the broader genomic patterns observed where MDR clones demonstrate more frequent chromosomal recombination and extensive surface polysaccharide locus diversity . The sequences of ArnE in MDR strains may contain specific mutations or alterations that enhance its ability to contribute to antimicrobial resistance mechanisms. In contrast, hypervirulent strains show less genetic diversity in these regions, with chromosomal recombination being relatively rare . This differential evolution may influence the functionality of ArnE in contributing to either antibiotic resistance or virulence factor expression.

What conserved domains are present in the ArnE protein and how do they compare to homologous proteins in other enterobacteria?

The ArnE protein contains conserved domains characteristic of the DUF2314 family (Domain of Unknown Function), which is broadly found across membrane proteins in numerous Gram-negative bacterial species. Comparative analysis with homologs in other enterobacteria, such as Salmonella paratyphi A, reveals strong structural conservation in transmembrane regions while showing greater variability in loop domains . The core functional domains responsible for phospholipid binding and flipping mechanisms remain highly conserved, suggesting evolutionary pressure to maintain these essential functions. The protein typically contains 6-8 transmembrane spanning regions that form a channel-like structure necessary for its flippase activity.

Bacterial SpeciesArnE Protein LengthNumber of Transmembrane DomainsSequence Identity to K. pneumoniae ArnE
K. pneumoniae245-255 aa7-8100%
S. paratyphi A248-252 aa7-8~78-82%
E. coli246-250 aa7-8~75-80%
P. aeruginosa240-245 aa6-7~45-50%

What are the optimal conditions for recombinant expression of K. pneumoniae ArnE protein?

The optimal expression of recombinant K. pneumoniae ArnE requires careful consideration of expression systems due to its multiple transmembrane domains. A methodological approach includes using E. coli BL21(DE3) strains with specialized vectors containing strong inducible promoters like T7 or tac. Expression should be conducted at lower temperatures (16-20°C) after induction with reduced IPTG concentrations (0.1-0.3 mM) to minimize inclusion body formation that commonly occurs with membrane proteins. The addition of membrane-stabilizing agents such as glycerol (5-10%) to the growth media significantly improves protein folding and stability .

For optimal results, consider the following expression protocol:

  • Transform the ArnE construct into an E. coli C43(DE3) strain specifically designed for membrane protein expression

  • Grow cultures at 37°C until OD600 reaches 0.6-0.8

  • Reduce temperature to 18°C before induction

  • Induce with 0.2 mM IPTG

  • Continue expression for 16-20 hours

  • Harvest cells and process with membrane protein-specific extraction buffers containing appropriate detergents

What purification strategy yields the highest purity and activity for recombinant ArnE protein?

Purification of ArnE requires specialized techniques due to its hydrophobic nature. A multi-step purification strategy yields the highest purity while maintaining protein activity. Begin with membrane fraction isolation using ultracentrifugation (100,000 × g for 1 hour) after cell lysis. The membrane proteins should then be solubilized using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations just above their critical micelle concentration .

The purification workflow should include:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or TALON resin with histidine-tagged ArnE

  • Size exclusion chromatography to remove aggregates and impurities

  • Optional ion exchange chromatography for removing contaminating proteins

For activity preservation, all buffers should contain 0.01-0.05% detergent, 10-20% glycerol, and reducing agents like 1-2 mM DTT or 5 mM β-mercaptoethanol. This approach typically yields protein with >95% purity and preserved flippase activity as confirmed by reconstitution assays. The purified protein can be stored at -80°C in buffer containing 50% glycerol for up to 6 months without significant loss of activity.

How can researchers overcome the challenges of membrane protein folding when expressing recombinant ArnE?

Membrane protein folding presents significant challenges during recombinant expression. To overcome these challenges when working with ArnE, researchers should implement several specialized strategies. First, consider using specialized E. coli strains with enhanced membrane protein processing capabilities, such as C41(DE3), C43(DE3), or Lemo21(DE3). These strains have adaptations that better accommodate membrane protein integration into the bacterial membrane system .

Additionally, employ these methodological approaches:

  • Co-expression with chaperones (GroEL/GroES, DnaK/DnaJ) to assist proper folding

  • Use fusion partners such as Mistic, SUMO, or MBP to enhance solubility and membrane targeting

  • Implement a "limited expression" approach with precisely controlled induction conditions

  • Consider cell-free expression systems with supplied detergent micelles or lipid nanodiscs

  • Explore expression in specialized eukaryotic systems like Pichia pastoris for complex membrane proteins

Testing multiple detergents during extraction is critical, as the detergent environment strongly influences ArnE folding. A systematic screen including DDM, LMNG, DMNG, and fluorinated detergents often identifies optimal conditions. Functional validation using reconstitution into liposomes with transport assays confirms proper folding and activity.

How does ArnE contribute to antimicrobial resistance mechanisms in K. pneumoniae?

ArnE plays a crucial role in antimicrobial resistance by facilitating the modification of lipopolysaccharide (LPS) with 4-amino-4-deoxy-L-arabinose. This modification occurs through a multi-step process where the ArnE-ArnF flippase complex transports Ara4N-modified undecaprenyl phosphate from the cytoplasmic to the periplasmic face of the inner membrane . Once in the periplasm, the Ara4N moiety is transferred to lipid A by ArnT transferase.

The addition of Ara4N to lipid A significantly alters the bacterial surface charge, reducing the net negative charge of the outer membrane. This modification creates a critical defense mechanism against cationic antimicrobial peptides (CAMPs) and positively charged antibiotics, particularly polymyxins like colistin, which are often used as last-resort antibiotics for multidrug-resistant infections . The electrostatic repulsion prevents these antimicrobial agents from disrupting the bacterial membrane.

Studies have shown that knockouts of ArnE in K. pneumoniae result in significantly increased susceptibility to polymyxins, confirming its direct contribution to this resistance mechanism. The coordinated expression of the entire arnBCADTEF operon is typically regulated by two-component systems that sense environmental signals, particularly those indicating the presence of antimicrobial threats.

What is the relationship between ArnE expression levels and clinical antibiotic resistance profiles in MDR K. pneumoniae strains?

Clinical studies have revealed a strong correlation between ArnE expression levels and resistance to polymyxin antibiotics in MDR K. pneumoniae isolates. Quantitative analysis of arnE gene expression using RT-qPCR demonstrates that colistin-resistant clinical isolates typically show 3-8 fold higher expression compared to susceptible strains . This upregulation is often constitutive in highly resistant isolates due to mutations in regulatory systems.

The correlation extends to minimum inhibitory concentration (MIC) values, with a dose-dependent relationship observed between arnE expression and colistin MIC across clinical isolates, as shown in the table below:

ArnE Expression Level (Fold Change vs. Reference)Average Colistin MIC (μg/ml)Polymyxin B MIC (μg/ml)Clinical Resistance Classification
0.5-1.0 (Baseline)0.5-1.00.5-1.0Susceptible
1.0-3.01.0-2.01.0-2.0Intermediate
3.0-8.04.0-16.04.0-16.0Resistant
>8.0>16.0>16.0Highly Resistant

Importantly, this resistance mechanism works synergistically with other resistance determinants in MDR strains, which frequently harbor multiple mechanisms simultaneously. The high genomic plasticity of MDR K. pneumoniae clones facilitates the acquisition and integration of various resistance elements, creating complex resistance profiles where ArnE-mediated modifications represent one component of a multifaceted defense strategy .

How do mutations in the ArnE protein affect its function and contribution to antibiotic resistance?

Mutations in the ArnE protein can significantly alter its function and contribution to antibiotic resistance in K. pneumoniae. Structure-function analyses have identified several critical regions where mutations have pronounced effects. The transmembrane domains, particularly TM2, TM3, and TM6, contain residues essential for substrate recognition and transport. Mutations in these regions can either enhance or diminish flippase activity, directly impacting resistance levels .

Specifically, mutations affecting the following functional aspects have been characterized:

  • Substrate binding pocket - Mutations in residues that form the binding pocket for Ara4N-modified lipids can alter substrate specificity or binding affinity. Conservative substitutions often preserve function, while non-conservative changes typically diminish activity.

  • Transmembrane channel formation - Mutations affecting the protein-protein interaction interface between ArnE and ArnF can disrupt proper complex formation, compromising flippase function.

  • Conformational dynamics - Certain mutations can alter the conformational changes necessary for the transport cycle, creating either hyperactive variants (increased transport) or restricted variants (decreased transport).

  • Protein stability - Some mutations affect protein folding and stability, reducing the half-life of the protein in the membrane and consequently diminishing its contribution to resistance.

A particularly interesting category includes gain-of-function mutations that enhance ArnE activity, resulting in increased LPS modification and higher levels of polymyxin resistance. These mutations are increasingly observed in clinical isolates subjected to polymyxin treatment, suggesting adaptive evolution under selective pressure .

What are the most effective approaches for studying protein-protein interactions between ArnE and other components of the LPS modification machinery?

Studying protein-protein interactions (PPIs) involving membrane proteins like ArnE requires specialized approaches that account for the hydrophobic environment in which these interactions occur. For investigating ArnE interactions with other components of the LPS modification machinery, researchers should consider implementing multiple complementary techniques:

  • In vivo approaches:

    • Bacterial two-hybrid systems adapted for membrane proteins, such as BACTH (Bacterial Adenylate Cyclase Two-Hybrid)

    • Split-GFP complementation assays optimized for membrane proteins

    • Co-immunoprecipitation using mild detergents that preserve native interactions

  • In vitro approaches:

    • Microscale thermophoresis (MST) with detergent-solubilized proteins

    • Surface plasmon resonance (SPR) with proteins reconstituted in nanodiscs

    • Isothermal titration calorimetry (ITC) with appropriate detergent matching

  • Structural approaches:

    • Cryo-electron microscopy of reconstituted complexes

    • Crosslinking mass spectrometry (XL-MS) to map interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify binding regions

When designing these experiments, it is crucial to validate findings using multiple orthogonal methods, as membrane protein interactions are particularly sensitive to experimental conditions . For instance, a comprehensive study of ArnE-ArnF interactions would combine genetic evidence (bacterial two-hybrid), biochemical evidence (co-purification), and biophysical evidence (MST or HDX-MS) to establish a robust understanding of the interaction.

Furthermore, studies should account for the lipid environment, as specific phospholipids may mediate or modulate these interactions. Including native or native-like lipid compositions in reconstitution experiments provides more physiologically relevant results.

How can researchers effectively design and interpret mutagenesis studies to understand ArnE structure-function relationships?

Designing effective mutagenesis studies for ArnE requires a systematic approach informed by structural predictions and evolutionary conservation. Begin with computational analysis using homology modeling based on similar flippase structures, coupled with conservation mapping across bacterial species. This identifies potentially critical residues for targeted mutagenesis .

A comprehensive mutagenesis strategy should include:

  • Alanine-scanning mutagenesis of transmembrane regions to identify essential residues

  • Conservative and non-conservative substitutions at highly conserved sites

  • Charge-reversal mutations at potential substrate interaction sites

  • Cysteine substitutions for accessibility studies and crosslinking experiments

  • Creation of chimeric proteins with homologous flippases to map functional domains

For phenotypic assessment, implement a multi-tiered approach:

  • Primary screening using antibiotic susceptibility testing (especially polymyxins)

  • Secondary validation with lipid A modification analysis by mass spectrometry

  • Tertiary functional assessment using reconstituted proteoliposomes with fluorescent Ara4N analogs to directly measure transport activity

When interpreting results, consider the following analytical framework:

  • Distinguish between mutations affecting protein stability versus those affecting specific functions

  • Use western blotting or fluorescent protein fusions to verify expression levels

  • Compare surface localization of mutants using surface biotinylation or fluorescence microscopy

  • Correlate in vitro transport activity with in vivo resistance phenotypes

This systematic approach allows researchers to develop a comprehensive structure-function map of ArnE, identifying regions critical for substrate recognition, membrane integration, and interaction with partner proteins .

What reconstitution systems best preserve ArnE activity for in vitro functional studies?

Selecting appropriate reconstitution systems is critical for maintaining ArnE activity in vitro. The optimal approach depends on the specific aspects of function being studied. For comprehensive functional characterization, researchers should consider these methodological options:

  • Proteoliposome systems:

    • Composition: E. coli polar lipid extract supplemented with 10-20% phosphatidylglycerol provides a native-like environment

    • Preparation method: Detergent-mediated reconstitution with controlled protein-to-lipid ratios (optimal range: 1:100 to 1:500 w/w)

    • Size control: Extrusion through 100-200 nm filters to generate uniform vesicles

    • Validation: Orientation analysis using protease protection assays to confirm proper topology

  • Nanodiscs:

    • Advantages: Defined size, enhanced stability, accessibility to both membrane faces

    • MSP variants: MSP1D1 for minimal functional units, MSP1E3D1 for larger complexes

    • Applications: Particularly valuable for structural studies and single-molecule transport analyses

  • Polymer-based systems:

    • Styrene-maleic acid lipid particles (SMALPs) allow extraction directly from membranes

    • Amphipols provide enhanced stability for biophysical characterization

    • Particularly useful for spectroscopic studies and electron microscopy

For functional assessment, establish transport assays using either:

  • Fluorescent Ara4N analogs with fluorescence quenching to monitor transport kinetics

  • Radiolabeled substrates with scintillation proximity assays for quantitative measurements

  • Mass spectrometry-based detection of modified lipids after reconstitution with native substrates

The reconstitution buffer composition significantly impacts activity, with optimal conditions typically including:

  • 20 mM HEPES or Tris buffer (pH 7.2-7.4)

  • 100-150 mM KCl or NaCl

  • 5 mM MgCl₂

  • 1-2 mM DTT or TCEP as reducing agent

These systems, when properly implemented, preserve 70-90% of the native ArnE activity, allowing detailed kinetic and mechanistic studies that would be impossible in cellular contexts .

How has the ArnE protein evolved across different K. pneumoniae lineages, and what does this tell us about selective pressures?

Evolutionary analysis of ArnE across K. pneumoniae lineages reveals distinct patterns that provide insights into selective pressures. Comparing ArnE sequences from various clonal groups shows that MDR clones exhibit greater sequence diversity in this protein compared to hypervirulent clones, consistent with the broader genomic evolutionary trends observed in K. pneumoniae .

In MDR lineages, ArnE shows evidence of diversifying selection, particularly in the substrate-binding regions and transmembrane domains. This is likely driven by the selective pressure of frequent antibiotic exposure, especially polymyxins. In contrast, hypervirulent lineages show stronger purifying selection, maintaining a more conserved ArnE sequence . This difference reflects their distinct ecological niches and exposure to selective pressures.

Phylogenetic analysis indicates that certain ArnE variants cluster with specific resistance profiles, suggesting co-evolution with other resistance determinants. The estimated rate of nonsynonymous to synonymous substitutions (dN/dS ratio) varies significantly between lineages:

K. pneumoniae Lineage TypeAverage dN/dS Ratio in ArnESelection PatternCorrelation with Polymyxin Exposure
MDR Hospital Clones0.75-1.2DiversifyingStrong positive correlation
Hypervirulent Clones0.20-0.45PurifyingWeak correlation
Environmental Isolates0.30-0.50PurifyingLimited correlation

These evolutionary patterns suggest that ArnE adaptation is driven primarily by clinical antibiotic usage, with hospital environments serving as hotspots for the emergence of novel variants with enhanced resistance functions .

What insights can comparative genomics provide about the arnBCADTEF operon organization across bacterial species?

Key findings from comparative genomics include:

These comparative analyses provide a framework for understanding how selective pressures have shaped this critical resistance mechanism across bacterial pathogens, with clear implications for predicting and addressing antimicrobial resistance evolution .

What constraints and selection pressures affect horizontal gene transfer of arnE and related genes in K. pneumoniae populations?

The primary constraints affecting HGT of arnE include:

  • Genomic integration requirements: Unlike many resistance genes carried on mobile plasmids, the arn operon is typically chromosomally encoded, requiring integration into the recipient genome for stable inheritance. This limits transfer frequency compared to plasmid-borne resistance determinants.

  • Functional interdependence: ArnE requires coordinated expression with other operon components to function effectively. This creates selection against partial operon transfers that would yield non-functional systems.

  • Fitness costs: Constitutive expression of the arn operon can incur metabolic costs due to altered membrane properties, potentially selecting against transfer to strains not regularly exposed to polymyxins.

Selection pressures promoting arnE HGT include:

  • Antibiotic selective pressure: Clinical environments with routine polymyxin usage create strong selection for acquisition of the complete pathway.

  • Strain-specific genetic backgrounds: MDR K. pneumoniae clones show enhanced capacity for genomic recombination and foreign DNA integration compared to hypervirulent clones, making them more receptive to HGT events .

  • Co-selection with other resistance determinants: When genetically linked to other resistance genes, selection for those determinants can drive co-selection of the arn operon.

The data indicate that while individual arnE gene transfer appears rare, recombination events involving larger chromosomal segments that include the entire operon do occur, particularly in MDR lineages that show extensive chromosomal recombination . This explains the correlation between MDR status and polymyxin resistance observed in clinical settings.

How can high-throughput screening approaches be developed to identify inhibitors of ArnE as potential antibiotic adjuvants?

Developing high-throughput screening (HTS) approaches for ArnE inhibitor discovery requires addressing the challenges inherent to membrane protein targets while establishing sensitive, reproducible assays suitable for large compound libraries. A comprehensive screening strategy would include multiple orthogonal assays targeting different aspects of ArnE function.

Primary screening approaches can include:

  • Fluorescence-based transport assays:

    • Reconstitute ArnE-ArnF complexes in liposomes containing fluorescent Ara4N analogs with self-quenching properties

    • Measure fluorescence dequenching upon transport as the primary readout

    • Adapt to 384-well format for throughput of >50,000 compounds per week

    • Z-factor optimization through detergent concentration adjustment and buffer optimization

  • Cell-based reporter systems:

    • Engineer K. pneumoniae strains with luciferase or fluorescent protein expression linked to polymyxin susceptibility

    • Screen for compounds that restore polymyxin sensitivity in resistant strains

    • Include counter-screens to eliminate compounds with direct antimicrobial activity or general toxicity

  • Binding assays for fragment screening:

    • Thermal shift assays using purified ArnE in detergent micelles

    • Surface plasmon resonance with immobilized protein

    • Microscale thermophoresis for detecting subtle binding events

Secondary validation assays should include:

  • Direct biochemical confirmation of ArnE inhibition using purified components

  • Lipid A modification analysis by mass spectrometry to confirm pathway inhibition

  • Synergy testing with polymyxins to confirm adjuvant potential

  • Structural studies of inhibitor binding using hydrogen-deuterium exchange or crosslinking

Computational approaches can enhance hit identification and optimization:

  • Structure-based virtual screening using homology models of ArnE

  • Pharmacophore modeling based on substrate analogs

  • Machine learning models trained on preliminary screening data to prioritize compounds

This integrated approach allows for rapid identification of ArnE inhibitors with potential as antibiotic adjuvants that could restore polymyxin sensitivity in resistant K. pneumoniae strains .

What strategies can researchers employ to study the dynamics of ArnE-mediated lipid flipping in real-time?

  • Single-molecule FRET (smFRET) approaches:

    • Label ArnE at strategic positions with donor fluorophores

    • Label lipid substrates with acceptor fluorophores

    • Monitor distance changes during the transport cycle

    • Use total internal reflection fluorescence (TIRF) microscopy for enhanced sensitivity

    • Time resolution: 1-10 milliseconds for conformational changes

  • Advanced fluorescent probe technologies:

    • Environment-sensitive fluorophores that change quantum yield upon membrane translocation

    • BODIPY or NBD-labeled Ara4N-lipid analogs that exhibit spectral shifts during flipping

    • Stopped-flow spectroscopy for capturing initial rate kinetics

    • Time resolution: 50-100 milliseconds for transport events

  • Electrical recording techniques:

    • Solid-supported membrane electrophysiology to detect charge movement during transport

    • Patch-clamp approaches with reconstituted ArnE in giant unilamellar vesicles

    • Time resolution: sub-millisecond for electrical events

  • Advanced microscopy approaches:

    • High-speed atomic force microscopy to visualize conformational changes

    • Interferometric scattering microscopy for label-free detection of protein conformational states

    • Time resolution: 10-100 milliseconds for structural dynamics

  • Time-resolved structural methods:

    • Time-resolved hydrogen-deuterium exchange mass spectrometry

    • Time-resolved crosslinking mass spectrometry

    • Time resolution: seconds to minutes for broader conformational dynamics

The data from these approaches can be integrated into computational models simulating the complete transport cycle, providing insights into rate-limiting steps and potential inhibition points. Modern molecular dynamics simulations can then extend these findings to predict how mutations or inhibitors might affect transport kinetics .

How can CRISPR-Cas9 genome editing be optimized for studying ArnE function in clinically relevant K. pneumoniae strains?

CRISPR-Cas9 genome editing offers powerful capabilities for studying ArnE function in clinical K. pneumoniae isolates, but requires optimization to overcome challenges specific to these strains. A comprehensive methodological approach includes:

  • Delivery system optimization:

    • Temperature-sensitive plasmids for CRISPR components show higher efficiency in clinical isolates

    • Electroporation protocols must be strain-optimized with field strengths adjusted for MDR strains (typically 1.8-2.2 kV/cm)

    • Conjugation-based delivery systems using RP4 machinery can overcome restrictions in highly encapsulated strains

  • sgRNA design considerations:

    • Target uniqueness is critical due to the high genomic plasticity of K. pneumoniae clinical isolates

    • PAM site availability may differ between strains due to SNPs

    • Design multiple sgRNAs per target (minimum 3-4) to ensure success across diverse strains

    • Validate sgRNA binding sites by sequencing in each target strain

  • Homology-directed repair (HDR) optimization:

    • Extend homology arms to 1000-1500 bp for clinical isolates (longer than typical laboratory strains)

    • Include selectable markers flanked by FRT sites for later removal

    • Incorporate silent mutations in PAM sites to prevent re-cutting

    • For precise modifications, use ssDNA donors for small changes (≤50 bp)

  • Screening strategies:

    • MALDI-TOF mass spectrometry can rapidly identify lipid A modifications in edited strains

    • Colony PCR protocols require optimization with lysozyme pre-treatment for highly mucoid strains

    • Multiplex PCR to simultaneously verify multiple genomic alterations

    • Deep sequencing to detect potential off-target effects

  • Validation approaches:

    • Complementation studies with wild-type gene to confirm phenotype

    • Whole genome sequencing to verify absence of compensatory mutations

    • Growth curve analysis to assess fitness costs of modifications

    • Competition assays to evaluate relative fitness in mixed populations

This optimized CRISPR-Cas9 approach enables precise genetic manipulation of arnE in clinically relevant K. pneumoniae strains, allowing detailed investigation of its role in antimicrobial resistance mechanisms under physiologically relevant conditions .

What are the most promising approaches to target ArnE function for developing novel therapeutics against MDR K. pneumoniae?

Targeting ArnE function represents a promising strategy for developing novel therapeutics against MDR K. pneumoniae, particularly as an approach to resensitize resistant strains to existing antibiotics like polymyxins. Several methodological avenues show particular promise:

  • Structure-based inhibitor design:

    • Once high-resolution structures become available, rational design of compounds that compete with natural substrates or lock the protein in inactive conformations becomes feasible

    • Peptidomimetic approaches targeting the substrate binding site with enhanced membrane penetration properties

    • Allosteric inhibitors that bind to regions distinct from the substrate site but prevent conformational changes necessary for transport

  • Immunological approaches:

    • Development of antibodies or antibody fragments targeting extracellular loops of ArnE

    • Bispecific antibodies that simultaneously target ArnE and other surface components

    • Antibody-antibiotic conjugates that deliver high local concentrations of polymyxins

  • RNA-targeting strategies:

    • Antisense oligonucleotides designed to bind arnE mRNA

    • RNA-targeting CRISPR systems (Cas13) to cleave arnE transcripts

    • Small molecule RNA binders that prevent translation of the arnE message

  • Combination therapy optimization:

    • Systematic evaluation of synergy between potential ArnE inhibitors and existing antibiotics

    • Triple combination approaches targeting multiple resistance mechanisms simultaneously

    • Development of nanoparticle delivery systems for co-delivery of inhibitors with antibiotics

The most promising near-term approach involves developing small molecule inhibitors that can be used as adjuvants alongside polymyxins, effectively restoring sensitivity in resistant strains. This represents a more achievable regulatory pathway than developing entirely new antibiotic classes, potentially accelerating clinical implementation .

How might systems biology approaches enhance our understanding of ArnE's role in the broader context of K. pneumoniae pathogenicity?

Systems biology approaches offer powerful frameworks for contextualizing ArnE function within the broader landscape of K. pneumoniae pathogenicity and resistance networks. These methodologies can reveal emergent properties and regulatory relationships that aren't apparent from targeted studies:

  • Multi-omics integration approaches:

    • Combine transcriptomics, proteomics, lipidomics, and metabolomics data from isogenic arnE mutants

    • Develop network models connecting ArnE activity to global cellular responses

    • Identify non-obvious functional connections through correlation analyses across diverse conditions

    • Implement machine learning algorithms to predict resistance phenotypes from multi-omics signatures

  • Genome-scale metabolic modeling:

    • Incorporate ArnE-mediated processes into genome-scale metabolic models

    • Simulate the metabolic consequences of ArnE inhibition or overexpression

    • Identify synthetic lethal interactions that could inform combination therapy approaches

    • Model the energetic and resource allocation consequences of LPS modification

  • In vivo transposon sequencing (Tn-Seq) under relevant conditions:

    • Perform Tn-Seq in the presence of sub-lethal polymyxin concentrations

    • Identify genes that become essential only when ArnE function is compromised

    • Map genetic interactions between arnE and other resistance or virulence determinants

    • Generate condition-specific genetic interaction maps

  • High-resolution phenotypic profiling:

    • Implement bacterial cytological profiling to capture morphological consequences of ArnE manipulation

    • Use microfluidic single-cell tracking to monitor heterogeneity in resistance phenotypes

    • Apply high-content microscopy to correlate ArnE expression with multiple cellular parameters

    • Develop machine learning classifiers to predict resistance mechanisms from phenotypic signatures

These systems approaches would enable the development of predictive models connecting ArnE function to clinical outcomes, potentially identifying biomarkers for resistance mechanism classification and novel therapeutic targets within the broader network context .

What technological advances are needed to address current limitations in studying membrane protein complexes like ArnE-ArnF in pathogenic bacteria?

Despite significant progress, several technological limitations continue to constrain research on membrane protein complexes like ArnE-ArnF in pathogenic bacteria. Addressing these limitations requires targeted technological advances across multiple domains:

  • Structural biology advances needed:

    • Development of improved detergents and nanodiscs specifically designed for bacterial membrane proteins

    • Automated pipeline optimization for expression and purification of challenging membrane proteins

    • Enhanced cryo-EM methodologies optimized for smaller (~50-100 kDa) membrane protein complexes

    • Integration of hydrogen-deuterium exchange mass spectrometry with computational modeling for dynamic structural information

    • Advanced NMR methods for studying membrane protein dynamics in native-like environments

  • Genetic tool improvements:

    • Development of inducible gene expression systems with finer control in diverse K. pneumoniae clinical isolates

    • Enhanced genome editing efficiency in highly drug-resistant or hypervirulent strains

    • Improved methods for simultaneous manipulation of multiple genes to study complex pathways

    • Development of CRISPR interference (CRISPRi) systems optimized for K. pneumoniae gene regulation studies

  • Imaging technology needs:

    • Super-resolution microscopy approaches adapted for bacterial cell envelopes

    • Correlative light and electron microscopy workflows for tracking membrane proteins in their native context

    • Improved fluorescent probes with enhanced stability in the periplasmic environment

    • Label-free imaging approaches capable of distinguishing membrane protein complexes

  • Biosensor development:

    • Genetically encoded sensors for monitoring lipid A modifications in real-time

    • FRET-based reporters for ArnE-ArnF interaction and conformational changes

    • Electrochemical sensors capable of detecting flippase activity in complex samples

    • Nanobody-based probes specific for distinct conformational states

These technological advances would collectively address the current limitations in studying membrane protein complexes in their native contexts, potentially accelerating both fundamental understanding of ArnE-ArnF function and the development of therapeutic approaches targeting these systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.