Recombinant Klebsiella pneumoniae subsp. pneumoniae Probable intracellular septation protein A (KPN78578_12170)

Shipped with Ice Packs
In Stock

Description

Research Applications

This recombinant protein is primarily used in:

  1. Antibody Development: As an antigen for generating antibodies to study K. pneumoniae virulence mechanisms .

  2. Structural Studies: For resolving 3D conformations to identify drug-binding pockets .

  3. Host-Pathogen Interaction Screens: To map bacterial proteins interacting with host immune factors .

Interaction Networks and Host Targets

Although KPN78578_12170’s interactome is uncharacterized, K. pneumoniae proteins with analogous roles often target host pathways such as:

  • Hypoxia Signaling: Via HIF1A and STAT1, which cross-talk with tumor suppressor P53 to modulate immune responses .

  • DNA Damage Repair: Disruption of host DNA repair machinery aids immune evasion .

A phylogenetic analysis places KPN78578_12170 in a clade with conserved septation-related proteins from Enterobacteriaceae, suggesting functional conservation .

Knowledge Gaps and Future Directions

  1. Functional Validation: No in vitro or in vivo studies confirm its role in septation.

  2. Therapeutic Potential: Unclear if targeting this protein could disrupt K. pneumoniae cell division or biofilm formation.

  3. Host Interactions: Screening against human protein libraries could reveal novel immune evasion mechanisms .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own adjustments.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; KPN78578_12170; KPN_01245; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Target Names
KPN78578_12170
Target Protein Sequence
MKQFLDFLPLVVFFAFYKLYDIYAATTALIVATAVVLIYSWVRYRKVEKMALITFVLVAV FGGLTIFFHNDEFIKWKVTVIYALFAGALLFSQWVMKKPLIQRMLGKELSLPQQVWSRLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLVFTLLSGIYIYRHMPQDDHH
Uniprot No.

Target Background

Function
This protein plays a critical role in cell envelope biogenesis, ensuring the integrity of the cell envelope and maintaining membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is KPN78578_12170 and what is its role in bacterial cell division?

KPN78578_12170, also known as YciB or inner membrane-spanning protein YciB, is a probable intracellular septation protein in Klebsiella pneumoniae involved in cell division processes. This 179-amino acid protein (UniProt ID: A6T7V7) functions as part of the bacterial divisome, the multi-protein complex that forms at the mid-cell to enable peptidoglycan synthesis and septation during bacterial cell division .

The protein likely participates in the highly coordinated process of septum formation, which involves:

  • Z-ring assembly at the division site

  • Recruitment of early divisome proteins (FtsA, ZipA)

  • Integration of late divisome components for peptidoglycan synthesis

  • Completion of septation and daughter cell separation

As an inner membrane protein, KPN78578_12170 may interact with other divisome components to facilitate proper septum formation during cell division, although its precise molecular mechanisms require further investigation.

How does KPN78578_12170 relate to other divisome proteins in bacterial cell division?

While the specific interactions of KPN78578_12170 with other divisome components are not fully characterized, it likely functions within the broader context of bacterial cell division machinery. Based on current understanding of divisome assembly:

  • FtsZ filaments form the Z-ring at the division site, which serves as a scaffold for recruiting other division proteins

  • Early divisome proteins like FtsA and ZipA anchor FtsZ to the cytoplasmic membrane

  • The FtsEX complex is recruited next, followed by the FtsQLB complex

  • Late divisome components including FtsW and FtsI catalyze peptidoglycan synthesis at the septum

As an inner membrane protein involved in septation, KPN78578_12170 likely participates in this protein recruitment cascade, potentially interacting with other membrane-associated divisome components. Co-immunoprecipitation studies and bacterial two-hybrid assays would be valuable for mapping these protein-protein interactions.

What are the optimal storage and handling conditions for recombinant KPN78578_12170?

For optimal preservation of recombinant KPN78578_12170 activity, follow these research-validated protocols:

Storage Conditions:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • After reconstitution, store at -20°C/-80°C with 5-50% glycerol (50% recommended)

  • Prepare working aliquots to avoid repeated freeze-thaw cycles

  • Short-term storage of working aliquots at 4°C for up to one week is acceptable

Reconstitution Protocol:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50%

  • Aliquot for long-term storage at -20°C/-80°C

Avoiding repeated freeze-thaw cycles is critical as membrane proteins are particularly susceptible to denaturation. The Tris/PBS-based buffer with 6% trehalose at pH 8.0 helps maintain protein stability during storage .

How can I express and purify recombinant KPN78578_12170 for functional studies?

For efficient expression and purification of KPN78578_12170:

Expression System:

  • E. coli is the recommended expression host for recombinant production

  • BL21(DE3) or similar strains designed for membrane protein expression are preferable

  • Consider using specialized vectors containing T7 or tac promoters

Expression Protocol:

  • Transform expression plasmid into competent E. coli cells

  • Culture transformed cells in LB medium with appropriate antibiotics

  • Induce protein expression with IPTG (0.1-1.0 mM) when OD600 reaches 0.6-0.8

  • Incubate at lower temperatures (16-25°C) for 16-20 hours to enhance proper folding

Purification Strategy:

  • Harvest cells by centrifugation and resuspend in lysis buffer

  • Disrupt cells using sonication or French press

  • Isolate membrane fraction by ultracentrifugation

  • Solubilize membrane proteins using detergents (DDM, LDAO, or OG)

  • Purify His-tagged protein using Ni-NTA affinity chromatography

  • Perform size exclusion chromatography for higher purity

This methodological approach enables production of KPN78578_12170 suitable for structural and functional analyses, including crystallography or interaction studies.

What techniques are most effective for generating KPN78578_12170 knockout mutants?

For creating isogenic KPN78578_12170 mutants in Klebsiella pneumoniae, the λ Red recombinase system has proven highly effective, as detailed below:

Materials Required:

  • pKD46 plasmid (or equivalent) carrying the λ Red recombinase genes

  • Antibiotic resistance cassette flanked by homology regions

  • Electrocompetent K. pneumoniae cells

  • pFLP plasmid (for generating unmarked deletions)

Protocol:

  • Prepare electrocompetent K. pneumoniae cells harboring pKD46:

    • Culture cells at 30°C with arabinose to induce recombinase expression

    • Harvest cells in exponential phase and wash extensively with ice-cold glycerol

  • Generate targeting construct:

    • Design primers with 40-50bp homology arms flanking KPN78578_12170

    • PCR amplify antibiotic resistance cassette with these primers

    • Purify the PCR product

  • Perform recombineering:

    • Electroporate the targeting construct into prepared cells

    • Select recombinants on antibiotic-containing media

    • Verify gene replacement by colony PCR using primers outside the target region

  • Generate unmarked deletion (if desired):

    • Introduce pFLP plasmid to excise FRT-flanked resistance cassette

    • Culture at non-permissive temperature to eliminate pFLP

    • Verify loss of antibiotic resistance and correct deletion

  • Confirm absence of secondary mutations through whole-genome sequencing

This methodology enables precise genetic manipulation of Klebsiella pneumoniae to study the functional role of KPN78578_12170 in cell division and pathogenicity.

How can I investigate the role of KPN78578_12170 in antibiotic resistance mechanisms?

Investigating KPN78578_12170's potential role in antibiotic resistance requires a multi-faceted approach:

Experimental Design:

  • Generate isogenic knockout and overexpression strains:

    • Create KPN78578_12170 deletion mutants using λ Red recombineering

    • Construct complementation vectors carrying wild-type and mutant alleles

    • Create strains with inducible overexpression of KPN78578_12170

  • Perform antibiotic susceptibility testing:

    • Determine MIC values across multiple antibiotic classes

    • Compare wild-type, deletion, and complemented strains

    • Analyze growth kinetics under antibiotic stress

  • Assess cell envelope integrity:

    • Measure membrane permeability using fluorescent dyes (SYTOX green)

    • Analyze peptidoglycan composition by HPLC

    • Visualize septum formation using fluorescent D-amino acids and microscopy

  • Examine protein interactions:

    • Perform co-immunoprecipitation with other divisome components

    • Use bacterial two-hybrid assays to identify interaction partners

    • Analyze protein localization during antibiotic stress using fluorescent fusion proteins

  • Transcriptomic and proteomic analysis:

    • Compare expression profiles of wild-type and mutant strains

    • Identify compensatory mechanisms activated in deletion mutants

    • Analyze changes in divisome composition under antibiotic stress

This comprehensive approach can reveal whether KPN78578_12170 contributes to antibiotic resistance through altered septation, membrane integrity, or interactions with other resistance mechanisms in Klebsiella pneumoniae.

How does KPN78578_12170 function compare between classical and hypervirulent K. pneumoniae strains?

To investigate potential differences in KPN78578_12170 function between classical K. pneumoniae (cKP) and hypervirulent K. pneumoniae (hvKP) strains:

Comparative Analysis Methodology:

  • Sequence and expression analysis:

    • Compare KPN78578_12170 sequences across multiple cKP and hvKP isolates

    • Analyze promoter regions for regulatory differences

    • Quantify expression levels using RT-qPCR in different growth conditions

  • Functional characterization:

    • Generate knockout mutants in representative cKP and hvKP strains

    • Compare growth rates, cell morphology, and division patterns

    • Assess virulence using infection models (Galleria mellonella, mouse models)

  • Protein interaction network:

    • Perform comparative interactomics using pull-down assays

    • Identify strain-specific interaction partners

    • Map differences in divisome assembly pathways

Expected Findings Table:

ParameterClassical K. pneumoniaeHypervirulent K. pneumoniaeSignificance
Sequence conservationReferencePotential variationsMay indicate adaptive evolution
Expression levelBaselinePotentially alteredMay correlate with virulence
Impact of deletionGrowth defects expectedMay show different phenotypesIndicates differing functional importance
Interaction partnersCore divisome proteinsPotentially additional interactionsSuggests expanded functionality
Contribution to virulenceLikely minimalPotentially significantImportant for pathogenesis understanding

Understanding these differences could provide insights into the evolution of virulence in K. pneumoniae and potential strain-specific therapeutic targets .

What bioinformatic approaches can predict potential drug targets against KPN78578_12170?

For identifying KPN78578_12170 as a potential drug target, implement these computational approaches:

Comprehensive Target Assessment Pipeline:

  • Essentiality prediction:

    • Compare against databases of essential genes

    • Perform sequence-based homology analysis with known essential proteins

    • Use machine learning algorithms trained on essential protein features

  • Structural analysis:

    • Generate 3D models using homology modeling or ab initio prediction

    • Identify potential binding pockets using CASTp or SiteMap

    • Assess druggability of binding sites using DoGSiteScorer

  • Molecular dynamics simulations:

    • Analyze protein flexibility and conformational changes

    • Identify transient pockets not visible in static structures

    • Characterize water networks and potential displacement sites

  • Virtual screening:

    • Perform structure-based virtual screening against compound libraries

    • Implement pharmacophore-based screening for novel inhibitors

    • Use molecular docking to prioritize compounds for experimental validation

  • Network-based analysis:

    • Map protein-protein interaction networks centered on KPN78578_12170

    • Identify critical nodes and potential synthetic lethality partners

    • Predict effects of target inhibition on network integrity

This integrated bioinformatic approach enables identification of specific sites within KPN78578_12170 that could be targeted by small molecule inhibitors, potentially disrupting bacterial cell division while minimizing off-target effects on human proteins.

What are the major challenges in studying membrane-associated septation proteins like KPN78578_12170?

Researchers face several significant challenges when investigating membrane-associated septation proteins:

To address these challenges, researchers should consider employing:

  • Nanodiscs or styrene-maleic acid lipid particles (SMALPs) for native-like membrane environments

  • Super-resolution microscopy for visualizing dynamic protein interactions

  • Genetic approaches like CRISPR interference for temporal control of expression

  • Fragment-based drug discovery for identifying membrane protein binding partners

How might KPN78578_12170 contribute to the emerging convergent multidrug-resistant hypervirulent K. pneumoniae?

The emergence of convergent multidrug-resistant hypervirulent Klebsiella pneumoniae (MDR-hvKp) strains represents a significant public health threat. The potential contribution of KPN78578_12170 to this phenomenon can be investigated through:

  • Comparative genomics analysis:

    • Analyze KPN78578_12170 sequence variations across MDR-hvKp isolates

    • Identify single nucleotide polymorphisms or structural variations

    • Compare with classical and hypervirulent reference strains

  • Transcriptional regulation studies:

    • Investigate expression patterns under antibiotic stress

    • Analyze co-expression networks with virulence and resistance genes

    • Identify regulatory elements controlling KPN78578_12170 expression

  • Functional impact assessment:

    • Create isogenic mutants in MDR-hvKp backgrounds

    • Evaluate effects on both virulence and resistance phenotypes

    • Assess growth fitness under various environmental conditions

As MDR-hvKp strains have been reported across multiple continents with increasing frequency since 2008, understanding how cell division proteins like KPN78578_12170 might be modified or regulated differently in these convergent clones could provide insights into their successful emergence and spread .

What novel experimental approaches could elucidate the precise molecular function of KPN78578_12170?

To advance our understanding of KPN78578_12170's molecular function, several cutting-edge approaches should be considered:

  • Cryo-electron tomography:

    • Visualize KPN78578_12170 in its native membrane environment

    • Map its precise localization within the divisome

    • Observe structural changes during different cell division stages

  • In situ crosslinking coupled with mass spectrometry:

    • Identify transient protein-protein interactions

    • Map interaction interfaces at amino acid resolution

    • Characterize the dynamic interactome during cell division

  • Single-molecule tracking microscopy:

    • Monitor real-time protein dynamics during cell division

    • Quantify diffusion rates, residency times, and stoichiometry

    • Correlate protein movement with septum formation

  • CRISPR interference with inducible systems:

    • Create tunable depletion of KPN78578_12170

    • Identify the precise timing of its requirement during division

    • Determine minimum threshold levels needed for function

  • Reconstitution in synthetic membrane systems:

    • Reconstruct minimal divisome components in liposomes

    • Test sufficiency for driving membrane constriction

    • Analyze biophysical properties and force generation

These advanced approaches, particularly when used in combination, could provide unprecedented insights into how KPN78578_12170 contributes to bacterial cell division at the molecular level, potentially revealing new targets for antimicrobial development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.