Recombinant Klebsiella pneumoniae subsp. pneumoniae Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ubiB; KPN78578_42750; KPN_04331; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-546
Protein Length
full length protein
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Target Names
ubiB
Target Protein Sequence
MTPGELRRLYFIIHTFLSYGLDELIPKMRITLPLRIWRRMLFWMPNRHQDQPLGARLRLA LQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDRVAPFEGKLAQQQIEKAMGGLPVET WFDDFSVEPLASASIAQVHTARLKENGKEVVIKVIRPDILPIIKADMKLIYRLARWVPRL LPDGRRLRPQEVVREYEKTLLDELNLLRESANAIQLRRNFEDSPMLYVPEVYPDYCSESM MVMERIYGIPVSDVEALEAQGTNMQLLAERGVQVFFTQVFRDSFFHADMHPGNIFVSYEH PEDPQYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHVDSGWVPPDTNVEEFE FAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGVGRQLY PQLDLWKTAKPFLESWIKDQVGIPALVRAFKDKAPFWIERMPEIPELVYQSLQQSKQLQT SVDTIVRDMRVRHVRQGQSRYLFGIGAVLLLSGTLLFIHRPEWGMMPGWLMAGGVVTWLI GWRKTH
Uniprot No.

Target Background

Function
This protein is likely a kinase regulator of UbiI, an enzyme involved in the aerobic biosynthesis of coenzyme Q (ubiquinone).
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of UbiB in Klebsiella pneumoniae metabolism?

UbiB in K. pneumoniae plays a crucial role in ubiquinone (coenzyme Q) biosynthesis, which is essential for cellular respiration and energy production. UbiB functions as part of an O2-independent pathway for ubiquinone biosynthesis, allowing K. pneumoniae to synthesize this vital electron carrier across varying oxygen conditions . This metabolic flexibility contributes to the bacterium's ability to colonize diverse environments with fluctuating oxygen levels, which has significant implications for both pathogenicity and survival in host environments. The ability to maintain ubiquinone synthesis under anaerobic conditions provides K. pneumoniae with a metabolic advantage during infection, particularly in oxygen-limited host tissues.

How does UbiB contribute to ubiquinone biosynthesis in different oxygen environments?

UbiB is part of a novel O2-independent ubiquinone biosynthesis pathway that operates alongside the classical O2-dependent pathway. While the classical pathway requires oxygen as a substrate for hydroxylation reactions, the UbiB-associated pathway can function under anaerobic conditions. Research has identified that UbiB works in conjunction with other proteins, particularly UbiT (YhbT), UbiU (YhbU), and UbiV (YhbV), to enable ubiquinone synthesis across the entire O2 range .

The O2-independent pathway involves a unique mechanism where UbiU and UbiV form a heterodimer, with each protein binding a 4Fe-4S cluster via conserved cysteines that are essential for their hydroxylase activity. Together, these proteins constitute a novel class of O2-independent hydroxylases that can perform reactions typically requiring molecular oxygen . This dual pathway system (O2-dependent and O2-independent) allows K. pneumoniae to optimize its metabolism across varying oxygen conditions, contributing to its adaptability and pathogenicity.

How is the structure of UbiB protein characterized, and how does it relate to function?

UbiB in K. pneumoniae belongs to the protein kinase-like (PKL) superfamily, specifically within the UbiB family of atypical kinases . The protein contains characteristic domains including an ATP-binding site and the quintessential KxGQ motif, which is considered a defining feature of UbiB family proteins. Structural studies have revealed that small molecules like 2-propylphenol (2-PP), which mimics CoQ precursors, can modulate the KxGQ domain to increase nucleotide affinity and ATPase activity .

The protein's structure includes binding sites for both ATP and substrate molecules, supporting its role in energy-dependent biosynthetic processes. The 4Fe-4S clusters in associated proteins (UbiU-UbiV) are coordinated by conserved cysteine residues and are essential for the O2-independent hydroxylation reactions in ubiquinone biosynthesis . This structural arrangement allows UbiB to function effectively in anoxic environments, providing K. pneumoniae with metabolic flexibility that contributes to its pathogenicity and persistence.

What experimental approaches are recommended for studying UbiB function in K. pneumoniae?

A multi-faceted experimental approach is recommended for comprehensive analysis of UbiB function:

Genetic Manipulation:

  • Gene knockout using CRISPR-Cas9 or homologous recombination techniques

  • Complementation studies with wild-type and mutant variants

  • Site-directed mutagenesis of conserved residues to assess functional importance

  • Conditional expression systems to study essential gene functions

Biochemical Analysis:

  • Recombinant protein expression and purification under anaerobic conditions to preserve Fe-S clusters

  • ATPase activity assays to measure enzymatic function

  • Protein-protein interaction studies to identify binding partners

  • Spectroscopic analysis (UV-visible, EPR) to characterize iron-sulfur clusters

Physiological Studies:

  • Growth phenotyping under varying oxygen conditions

  • Ubiquinone quantification using HPLC or LC-MS

  • Respiratory chain activity measurements

  • Metabolomic analysis to track changes in ubiquinone precursors and related metabolites

In vivo Models:

  • Mouse infection models (BALB/c or C57BL/6J) to assess virulence of ubiB mutants

  • Alternative models like Caenorhabditis elegans or Galleria mellonella for high-throughput screening

Each approach provides complementary information, and combining multiple techniques yields the most comprehensive understanding of UbiB function.

What animal models are suitable for studying UbiB's role in K. pneumoniae pathogenesis?

Several animal models can be employed to study UbiB's role in K. pneumoniae pathogenesis, each with specific advantages:

Mouse Models:

  • BALB/c mice: Commonly used for respiratory infection models with K. pneumoniae, typically using 10³ CFU of K. pneumoniae in 50 μL solution administered intranasally

  • C57BL/6J mice: Useful for studying both respiratory and systemic infections

  • C3H/HeN female mice: Particularly valuable for urinary tract infection models, using transurethral inoculation of 1-2×10⁷ CFU in 50 μL

These mammalian models allow assessment of bacterial burden, inflammatory response (IL-6, IL-12, TNF-α, IL-1β), and histopathological changes .

Alternative Models:

  • Drosophila melanogaster (fruit fly): Enables high-throughput screening

  • Caenorhabditis elegans: Provides a simple model for studying host-pathogen interactions

  • Galleria mellonella (wax moth larvae): Offers a cost-effective infection model with a temperature range compatible with human pathogens

  • Danio rerio (zebrafish): Allows visualization of infection progression and innate immune response

When specifically studying UbiB's role, comparing wild-type K. pneumoniae with ubiB-knockout strains across different oxygen environments is particularly informative. This approach can reveal how UbiB contributes to bacterial survival and virulence under varying conditions.

How should recombinant K. pneumoniae UbiB protein be purified for functional studies?

Purification of recombinant K. pneumoniae UbiB protein requires specialized approaches due to its potential membrane association and iron-sulfur clusters:

Expression System Selection:

  • E. coli BL21(DE3) or C41/C43(DE3) strains engineered for membrane protein expression

  • Consider codon optimization if expression yields are low

  • Expression at lower temperatures (16-25°C) to improve proper folding

  • Induction with reduced IPTG concentrations (0.1-0.5 mM) to prevent inclusion body formation

Lysis and Extraction:

  • For membrane-associated UbiB, include appropriate detergents (0.5-1% n-dodecyl β-D-maltoside or 1% Triton X-100)

  • Buffer composition: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM DTT, protease inhibitors

  • For proteins with Fe-S clusters, consider anaerobic purification to maintain cluster integrity

Purification Steps:

  • Affinity chromatography (Ni-NTA for His-tagged proteins)

  • Size exclusion chromatography to separate aggregates and ensure homogeneity

  • Ion exchange chromatography as an additional purification step if needed

Quality Control:

  • SDS-PAGE and Western blot to assess purity and identity

  • Dynamic light scattering to evaluate homogeneity

  • Circular dichroism to verify proper folding

  • UV-visible spectroscopy to confirm Fe-S cluster presence (characteristic absorbance at 320-450 nm)

Maintaining reducing conditions throughout purification is crucial to preserve the structural and functional integrity of UbiB, particularly if it contains or interacts with iron-sulfur clusters.

How does UbiB contribute to K. pneumoniae virulence and antibiotic resistance?

UbiB's contribution to K. pneumoniae virulence and antibiotic resistance is multifaceted:

Metabolic Adaptation:
UbiB enables ubiquinone biosynthesis under varying oxygen conditions, allowing K. pneumoniae to adapt to diverse host environments. This metabolic flexibility is particularly important during infection as bacteria encounter oxygen gradients within host tissues. By maintaining energy production across these conditions, UbiB indirectly supports virulence factor expression and stress responses.

Connection to Hypervirulence:
Hypervirulent K. pneumoniae strains have emerged as a significant public health concern, causing severe infections in otherwise healthy individuals . These strains can acquire resistance to carbapenems and other antibiotics, creating "true and dreaded superbugs" . While the direct role of UbiB in hypervirulent strains has not been fully established, its function in maintaining energy metabolism under stress conditions may contribute to the enhanced fitness of these strains.

Antibiotic Resistance Mechanisms:
UbiB-mediated ubiquinone production affects several aspects of bacterial physiology that influence antibiotic resistance:

  • Membrane integrity: Ubiquinone contributes to membrane properties that can affect antibiotic penetration

  • Energy-dependent processes: Many resistance mechanisms, including efflux pumps, require energy from the electron transport chain

  • Persister formation: Metabolic adaptation via alternate respiratory pathways may contribute to persister cell formation and antimicrobial tolerance

Research methodologies to investigate these connections include:

  • Comparing antibiotic susceptibility of wild-type and ubiB mutant strains under varying oxygen conditions

  • Assessing membrane properties and efflux pump activity in relation to UbiB function

  • Examining transcriptional responses to antibiotics in strains with altered UbiB expression

What small molecule approaches can be used to study or target UbiB function?

Small molecule approaches for studying and targeting UbiB function include:

Inhibitor Development:
The development of selective UbiB inhibitors represents a promising approach both for studying UbiB function and for potential therapeutic applications. The 4-anilinoquinoline scaffold has been repurposed to selectively inhibit human COQ8A (a UbiB family member) in cells . Similar approaches could be applied to bacterial UbiB proteins, focusing on their unique structural features.

Activator Discovery:
Small molecules can also be used to modulate UbiB activity in a positive direction. For example, 2-propylphenol (2-PP), a CoQ precursor mimetic, has been shown to modulate the KxGQ domain in COQ8A to increase nucleotide affinity and ATPase activity . This approach provides insights into the regulatory mechanisms of UbiB proteins and potentially offers tools to enhance ubiquinone biosynthesis.

Methodological Approaches:

  • Structure-based design using crystal structures or homology models

  • High-throughput screening against purified UbiB protein

  • Cellular assays measuring ubiquinone production

  • Target validation using genetic and biochemical approaches

  • NMR and HDX-MS to characterize small molecule binding sites and conformational changes

These small molecule tools promise to provide new mechanistic insights into UbiB function and offer potential therapeutic strategies for addressing K. pneumoniae infections, particularly those caused by drug-resistant strains.

How can emerging technologies be applied to advance UbiB research?

Emerging technologies offer new opportunities for understanding UbiB function:

CRISPR-Cas9 Applications:

  • Precise genome editing to create knockout and knockin strains

  • CRISPRi for conditional gene repression when studying essential genes

  • Base editing for introducing specific point mutations

  • CRISPR screening to identify genetic interactions with ubiB

Advanced Structural Biology:

  • Cryo-electron microscopy for structure determination without crystallization

  • Integrative structural biology combining multiple data sources

  • Molecular dynamics simulations to understand protein dynamics

  • AlphaFold and related AI approaches for structure prediction

Systems Biology Approaches:

  • Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics)

  • Flux balance analysis to model metabolic changes

  • Network analysis to place UbiB in its broader biological context

  • Single-cell techniques to examine heterogeneity in bacterial populations

Microfluidics and Imaging:

  • Microfluidic devices to study bacterial growth under precise oxygen gradients

  • Time-lapse microscopy to track bacterial responses in real-time

  • Super-resolution microscopy to determine subcellular localization

  • FRET sensors to monitor protein-protein interactions

These technologies, when strategically combined, can provide unprecedented insights into UbiB function and its contribution to K. pneumoniae pathogenesis and antibiotic resistance.

What are common challenges in UbiB research and how can they be addressed?

Challenge 1: Protein Solubility and Stability Issues
UbiB proteins can be challenging to work with due to potential membrane association and iron-sulfur clusters. Researchers often encounter low yields or inactive protein.

Solutions:

  • Expression optimization: Lower temperatures (16-18°C), reduced inducer concentration

  • Fusion tags: MBP or SUMO tags to enhance solubility

  • Buffer optimization: Include glycerol, reducing agents, and appropriate detergents

  • Anaerobic techniques: Purify under anaerobic conditions to preserve Fe-S clusters

  • Liposome reconstitution: Incorporate purified protein into a membrane-like environment

Challenge 2: Functional Assay Development
Establishing reliable assays for UbiB activity can be difficult due to its integration in a complex biosynthetic pathway.

Solutions:

  • Direct assays: ATPase activity measurement using malachite green or coupled enzyme assays

  • Indirect assays: Monitor ubiquinone production in reconstituted systems

  • In vivo reporters: Develop genetic reporters linked to UbiB function

  • Thermal shift assays: Assess protein stability and ligand binding

Challenge 3: Distinguishing Direct vs. Indirect Effects
When studying UbiB's role in pathogenesis or resistance, separating direct from indirect effects poses a significant challenge.

Solutions:

  • Time-course experiments to establish cause-effect relationships

  • Complementation studies with point mutants affecting specific functions

  • Rescue experiments with metabolic intermediates

  • Comparative studies across multiple strain backgrounds

Challenge 4: Heterogeneity in Clinical Isolates
Clinical K. pneumoniae isolates show significant genetic diversity, complicating the generalization of UbiB function.

Solutions:

  • Comparative genomics across diverse isolates

  • Functional validation in multiple strain backgrounds

  • Population-level analysis of UbiB sequence and expression

  • Correlation of UbiB variants with clinical outcomes

How should contradictory results in UbiB knockout studies be interpreted?

When encountering contradictory results in UbiB knockout studies, consider the following analytical framework:

Experimental Condition Differences:
Carefully examine differences in experimental setup:

  • Oxygen levels: UbiB's importance likely varies across oxygen conditions

  • Growth media: Different carbon sources may affect dependence on UbiB

  • Growth phase: Impact of UbiB knockout may vary between exponential and stationary phases

  • Temperature and pH: These can affect alternative metabolic pathways

Genetic Background Considerations:

  • Strain-specific effects: Different K. pneumoniae strains may have varying dependence on UbiB

  • Compensatory mutations: Secondary mutations may arise to compensate for UbiB loss

  • Genetic interaction networks: The effect of UbiB knockout may depend on the status of interacting genes

Phenotypic Measurement Approaches:

  • Direct vs. indirect measures: Growth rate, ubiquinone levels, and virulence are distinct readouts

  • Sensitivity of assays: Some methods may not detect subtle phenotypic changes

  • Timing of measurements: Temporal dynamics can reveal phenotypes missed in endpoint analyses

Resolution Strategies:

  • Standardize conditions across experiments

  • Create isogenic mutants in multiple strain backgrounds

  • Complement mutations to confirm phenotype causality

  • Perform whole genome sequencing to identify potential compensatory mutations

  • Use quantitative rather than qualitative assays where possible

  • Develop mathematical models to explain context-dependent effects

Apparent contradictions often reveal important biological complexity rather than experimental failures, providing opportunities for deeper understanding of UbiB function.

What are the most promising avenues for future UbiB research in K. pneumoniae?

Several high-potential research directions for UbiB in K. pneumoniae warrant investigation:

UbiB as an Antimicrobial Target:
The O2-independent ubiquinone biosynthesis pathway represents a promising target for novel antimicrobials, particularly against hypervirulent and drug-resistant K. pneumoniae strains . Investigating the druggability of UbiB and developing selective inhibitors could lead to new therapeutic options for these challenging infections.

Role in Hypervirulent Strains:
The emergence of hypervirulent K. pneumoniae strains capable of infecting healthy individuals represents a significant public health concern . Understanding whether UbiB contributes to the enhanced virulence of these strains, particularly through metabolic adaptation, could provide insights into their pathogenesis and potential vulnerabilities.

Environmental Adaptation:
K. pneumoniae encounters varying oxygen conditions during infection and environmental persistence. Further research into how UbiB supports adaptation across these conditions would illuminate both pathogenesis mechanisms and ecological dynamics.

Systems Biology Integration:
Placing UbiB function within the broader context of K. pneumoniae metabolism using systems biology approaches could reveal non-obvious connections to virulence, resistance, and persistence. This includes exploring how UbiB activity affects global cellular processes through metabolic network analysis.

Evolutionary Considerations:
The widespread distribution of UbiB-related proteins across alpha-, beta-, and gammaproteobacteria, including many human pathogens , suggests important evolutionary dynamics. Comparative genomic and functional studies across species could reveal how this pathway has evolved and its significance in bacterial adaptation.

How might advances in UbiB research impact clinical approaches to K. pneumoniae infections?

Advances in UbiB research could transform clinical approaches to K. pneumoniae infections in several ways:

Novel Therapeutic Strategies:
Understanding UbiB's role in K. pneumoniae metabolism could lead to new drug development targeting this pathway. Since ubiquinone biosynthesis is essential for bacterial energy production, inhibitors of this pathway represent promising antimicrobial candidates, particularly for drug-resistant strains.

Biomarker Development:
Variations in ubiB expression or sequence could potentially serve as biomarkers for predicting:

  • Virulence potential of clinical isolates

  • Likelihood of developing antibiotic resistance

  • Responsiveness to specific therapeutic interventions

Combination Therapy Approaches:
Insights into how UbiB contributes to metabolic adaptation could inform rational combination therapy designs:

  • UbiB pathway inhibitors paired with conventional antibiotics

  • Targeting both O2-dependent and O2-independent ubiquinone biosynthesis

  • Drugs that prevent metabolic adaptation during antibiotic treatment

Diagnostics:
Knowledge of UbiB function could improve diagnostic approaches:

  • Rapid detection of hypervirulent strains based on UbiB-related genetic elements

  • Assessment of metabolic adaptability as a virulence indicator

  • Identification of strains likely to persist under antibiotic pressure

As research continues to elucidate the role of UbiB in K. pneumoniae pathogenesis, these clinical applications may become increasingly feasible, potentially offering new weapons against this challenging pathogen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.