Recombinant Klebsiella pneumoniae subsp. pneumoniae Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Biological Role

Lgt is the first enzyme in the lipoprotein biosynthesis pathway, enabling subsequent processing by signal peptidase II (Lsp) and apolipoprotein N-acyltransferase (Lnt) . In Klebsiella pneumoniae, lipoproteins contribute to outer membrane integrity, nutrient uptake, and virulence factor secretion. Depletion of Lgt disrupts lipoprotein anchoring, leading to membrane permeabilization, increased antibiotic sensitivity, and attenuated virulence in infection models .

Key functional features include:

  • Substrate specificity: Lgt recognizes the conserved lipobox motif (LXXC) in prolipoproteins.

  • Essentiality: Genetic knockout or depletion of lgt is lethal in Escherichia coli and K. pneumoniae .

  • Role in virulence: Lipoproteins modified by Lgt mediate host-pathogen interactions, immune evasion, and antibiotic resistance .

Challenges and Future Directions

  • Antibiotic resistance: Unlike downstream lipoprotein pathway enzymes (e.g., LspA), Lgt inhibition is not rescued by deletion of the major outer membrane lipoprotein Lpp, suggesting unique therapeutic potential .

  • Diagnostic potential: Lipoproteins modified by Lgt are candidate antigens for vaccines against K. pneumoniae .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. For specific delivery timelines, please consult your local distributors.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution, storing it at -20°C/-80°C. Our standard glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you require a specific tag type, please specify it, and we will prioritize its inclusion in the manufacturing process.
Synonyms
lgt; KPN78578_31740; KPN_03237; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Target Names
lgt
Target Protein Sequence
MNSGYLHFPEFDPVIFSLGPVSLHWYGLMYLVGFVFAMWLATRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNLPVFLADPLYLFRVWDGGMSFHGGLIGVILVMIIFARRT KRTFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPSFHYTMIFPGSRAEDLALLPTH PEWQSLFDTYGALPRHASQLYELALEGVVLFLILNLFIRKPRPTGSVSGLFLIGYGLFRI IVEFFRQPDAQFTGGWVQYISMGQILSIPMVLAGIIMMVWAYRHRPQQQNS
Uniprot No.

Target Background

Function
Klebsiella pneumoniae subsp. pneumoniae Prolipoprotein diacylglyceryl transferase (Lgt) is an enzyme that catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (lgt) in Klebsiella pneumoniae?

Prolipoprotein diacylglyceryl transferase (lgt) is an essential enzyme that catalyzes the first step in bacterial lipoprotein maturation pathway. It transfers a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the cysteine residue in the lipobox motif of prolipoprotein signal peptides. This modification anchors lipoproteins to the bacterial cell membrane, ensuring their proper localization and function. In K. pneumoniae, as in other Gram-negative bacteria, lgt plays a critical role in membrane integrity, nutrient acquisition, and virulence factor expression.

How does lgt contribute to K. pneumoniae virulence?

Lgt significantly contributes to K. pneumoniae virulence through multiple mechanisms. It enables proper anchoring of virulence-associated lipoproteins to the cell surface, supporting numerous functions essential for pathogenesis. Research has demonstrated that lgt mutation attenuates bacterial virulence and shortens colonization duration in murine models . This attenuation occurs because blocking lipidation by mutating lgt de-anchors lipoproteins from the cell surface, resulting in the release of immature preprolipoproteins into the extracellular milieu . This modification also abolishes the bacteria's ability to activate TLR2 signaling, thereby altering host immune recognition and response . Additionally, properly localized lipoproteins often participate in nutrient acquisition systems required during infection and may contribute to antibiotic resistance mechanisms.

What role does lgt play in bacterial immune evasion mechanisms?

Lgt-mediated lipoprotein modification plays a complex dual role in immune interactions. Properly lipidated bacterial proteins serve as pathogen-associated molecular patterns (PAMPs) that activate host TLR2 signaling pathways, triggering inflammatory responses. Paradoxically, this can both help clear infection and potentially contribute to tissue damage. Research has shown that lipoproteins are major TLR2 ligands in bacterial pathogens, required for Th17 responses and for inducing IRAK-4-dependent protective cytokines . Mutation of lgt abolishes the bacteria's ability to activate TLR2 signaling, which can alter the host immune recognition profile . This immune evasion mechanism can potentially allow bacteria to avoid certain detection pathways, though it typically comes at the cost of reduced virulence, as observed in multiple experimental systems.

What experimental designs are most effective for studying lgt function in K. pneumoniae?

Effective experimental designs for studying lgt function in K. pneumoniae should incorporate principles of true experimental research design with proper controls and variable manipulation . The most robust approach involves:

Control vs. Experimental Groups: Generate isogenic lgt knockout mutants alongside wild-type strains and complemented mutants to establish causality. This controlled comparison enables researchers to attribute observed phenotypic changes specifically to lgt function .

Variable Manipulation: Systematically alter lgt expression levels using inducible promoters to observe dose-dependent effects on lipoprotein modification and cellular phenotypes .

Experimental ApproachMethodologyKey ControlsOutcome Measures
Gene knockout studiesCRISPR-Cas9 or homologous recombinationWild-type strain, Complemented mutantVerification by PCR, sequencing
Phenotypic characterizationGrowth curves, stress tolerance assaysGrowth in standard vs. stress conditionsSurvival rates, growth parameters
Virulence assessmentIn vitro infection models, animal modelsAvirulent strains, known virulence mutantsHost cell damage, bacterial burden
Lipoprotein localizationCell fractionation, western blottingCytoplasmic protein controlsSubcellular distribution of lipoproteins

For robust experimental designs, researchers should incorporate randomization of samples, technical replicates to minimize procedural variation, and biological replicates to account for strain-to-strain variation . Time-course sampling is also essential to track temporal changes in phenotypes following lgt modification.

How can researchers detect lateral gene transfer events involving lgt in K. pneumoniae strains?

Identifying lateral gene transfer (LGT) events involving lgt requires multiple complementary approaches to strengthen claims, as each method has its own strengths and weaknesses :

Phylogenetic incongruence analysis: Compare phylogenetic trees reconstructed from lgt sequences with species phylogeny based on 16S rRNA or whole-genome data. Significant incongruence may indicate LGT events . Statistical validation using tests such as the Approximately Unbiased (AU) test or Shimodaira-Hasegawa test provides quantitative evidence of tree topology differences.

Sequence composition analysis: Examine GC content, codon usage, and oligonucleotide frequencies of lgt genes compared to the genomic average. Deviations from typical genomic patterns may suggest foreign origin . Machine learning methods can be applied to determine whether codon usage in the lgt genes contradicts the discrimination of species using general codon usage in the genome.

Analysis MethodStatistical TestSignificance ThresholdPotential Confounding Factors
Phylogenetic incongruenceAU test, SH testp < 0.05Tree reconstruction artifacts, rate heterogeneity
Sequence compositionχ² test, Karlin signature> 2σ from genome meanRecent transfers may not show composition differences
BLAST similarity analysisComparison with control gene setsBased on distribution patternsGene loss, rate variation
Synteny analysisRandomization testsp < 0.05Genome rearrangements unrelated to LGT

The most convincing arguments for LGT depend on multiple lines of evidence from different methods, as demonstrated in studies of other bacterial genes such as nitrogen fixation genes .

What protocols yield optimal expression of recombinant K. pneumoniae lgt for structural and functional studies?

Optimizing expression of recombinant K. pneumoniae lgt requires careful consideration of expression systems, vector design, and purification strategies:

Expression System Selection:

  • E. coli-based systems: BL21(DE3) strains are commonly used, but specialized strains like C41/C43(DE3) better accommodate potentially toxic membrane proteins like lgt

  • Cell-free systems: May improve yield for difficult membrane proteins by eliminating cell viability concerns

  • Eukaryotic systems: Yeast or insect cell systems can provide alternative membrane environments for proper folding

Vector and Construct Design:

  • Include purification tags (His6, GST, MBP) positioned to avoid interference with transmembrane domains

  • Consider fusion partners that enhance solubility while maintaining function

  • Codon optimization for the expression host may significantly improve yields

Expression ParameterOptimization StrategyRationale
Induction temperatureTest range from 16-30°CLower temperatures often improve membrane protein folding
Inducer concentrationTitrate IPTG from 0.1-1.0 mMFind balance between expression and toxicity
Growth mediaCompare LB, TB, and auto-inductionRich media often improves membrane protein yield
Harvest timing4-16 hours post-inductionBalance between accumulation and potential degradation
Membrane extractionDetergent screening panelIdentify optimal detergent for solubilization

For structural studies, purification to homogeneity is essential, typically requiring multiple chromatography steps including affinity chromatography followed by size exclusion. Functional studies may benefit from reconstitution into nanodiscs or liposomes to provide a native-like membrane environment.

How can researchers differentiate between direct effects of lgt mutation and secondary consequences in K. pneumoniae?

Differentiating between direct effects of lgt mutation and secondary consequences requires systematic experimental approaches:

Genetic Complementation: The gold standard approach involves restoring wild-type phenotypes through complementation with functional lgt. This confirms that observed phenotypes are directly attributable to lgt loss rather than polar effects or secondary mutations . Complementation studies should include appropriate vector-only controls.

Timeline Analysis: Monitoring phenotypic changes immediately following controlled lgt inactivation (using inducible systems) can distinguish primary from secondary effects. Primary effects manifest rapidly, while secondary adaptations develop over time.

Targeted Lipoprotein Analysis: Direct lgt effects can be confirmed by demonstrating altered processing of specific lipoproteins known to be lgt substrates. Mass spectrometry can verify the absence of lipid modifications on prolipoproteins in lgt mutants.

Experimental ApproachControlsExpected Results for Direct EffectsInterpretation Notes
Complementation studiesVector-only, point mutantComplete phenotype restoration with wild-type lgtPartial restoration suggests secondary adaptations
Conditional expressionUninduced controlsRapid phenotypic changes upon lgt depletionDelayed effects may be indirect
Lipoprotein profilingWild-type comparisonConsistent mislocalization of all lipoproteinsSelective effects suggest pathway compensation
Transcriptome analysisTime-matched controlsLimited initial transcriptional responseBroad changes suggest stress response

Multivariate statistical approaches such as principal component analysis can help distinguish lgt-specific effects from general stress responses by identifying patterns specific to lgt mutation versus those common to various stress conditions.

What is the relationship between lgt function and antibiotic resistance in carbapenem-resistant K. pneumoniae?

The relationship between lgt function and antibiotic resistance in carbapenem-resistant K. pneumoniae (CRKP) is complex and multifaceted:

Carbapenem-resistant K. pneumoniae, particularly sequence type 11 (ST11), represents an urgent healthcare problem worldwide . While direct evidence linking lgt to carbapenem resistance mechanisms is limited, several potential connections exist:

  • Lipoprotein-mediated resistance mechanisms: Several lipoproteins contribute to antibiotic resistance, including β-lactamases and efflux pump components. Proper membrane anchoring via lgt may be necessary for optimal function of these resistance determinants.

  • Membrane integrity and permeability: Lgt ensures proper lipoprotein localization, which maintains membrane structure. Altered membrane properties in lgt mutants could potentially affect antibiotic penetration and activity.

  • Strain evolution through recombination: ST11 K. pneumoniae strains responsible for CRKP spread in China have undergone recombination events affecting surface structures . These evolutionary events may interact with lipoprotein function and presentation.

K. pneumoniae LineageCarbapenem ResistanceKnown Recombination EventsPotential Lgt Relevance
ST11-KL47Common in ChinaAncestral form before recombination Baseline lipoprotein processing
ST11-KL64Emerging concernDerived from ST11-KL47 through recombination May affect lipoprotein presentation
ST258Dominant KPC-associated clone in USMultiple recombination events documentedAltered surface antigenicity

Further research is needed to directly investigate how lgt function may contribute to carbapenem resistance mechanisms in these high-risk clones. This could involve comparing lgt sequence and expression between susceptible and resistant isolates, as well as examining the effects of lgt modification on minimum inhibitory concentrations.

How does lgt interact with other lipoprotein processing enzymes in the bacterial cell envelope?

Lgt functions within a coordinated lipoprotein processing pathway that includes multiple enzymatic steps:

Sequential Processing Pathway:

  • Lgt (Prolipoprotein diacylglyceryl transferase): Catalyzes the transfer of a diacylglyceryl moiety to the sulfhydryl group of the cysteine in the lipoprotein signal sequence

  • Lsp (Lipoprotein signal peptidase): Cleaves the signal peptide at the modified cysteine

  • Lnt (Apolipoprotein N-acyltransferase): Adds a third acyl chain to the amino group of the modified cysteine (in Gram-negative bacteria)

This sequential processing ensures proper lipoprotein maturation and localization. Disruption of lgt affects all downstream processing steps, as Lsp typically requires the diacylglyceryl modification to recognize its substrate.

EnzymeFunctionRelationship to LgtResearch Implications
LgtDiacylglyceryl transferInitial step in pathwayMutation affects all lipoprotein processing
LspSignal peptide cleavageRequires Lgt-modified substrateLsp substrates accumulate unprocessed in lgt mutants
LntN-acylation of lipoproteinsRequires Lsp-processed substrateActivity is irrelevant in lgt mutants
Lol system proteinsLipoprotein transportRecognize mature lipoproteinsTransport machinery functions but lacks properly prepared substrates in lgt mutants

Studies of lgt should consider this pathway context, as phenotypes observed in lgt mutants reflect the combined effect of disrupting the entire lipoprotein processing system. Comparing phenotypes between lgt, lsp, and lnt mutants can help disentangle the specific contributions of each processing step.

What are the main challenges in studying lgt mutants and how can they be addressed?

Studying lgt mutants presents several technical challenges that researchers must address through careful experimental design:

Growth Defects and Viability Issues:
Lgt mutation often leads to growth defects that can confound phenotypic analyses. These defects vary depending on growth conditions and bacterial genetic background. To address this challenge, researchers should:

  • Establish growth curves under experimental conditions to normalize for population differences

  • Consider using conditional expression systems for essential lgt genes

  • Employ viability staining to distinguish between viable, dormant, and dead cells

Lipoprotein Mislocalization vs. Function:
In lgt mutants, lipoproteins are produced but not properly anchored to the membrane, resulting in their release into the extracellular milieu . This creates a complex situation where:

  • Lipoproteins may still be present and partially functional despite improper localization

  • Released lipoproteins might exert effects at a distance from the bacterial cell

  • Phenotypes may result from either absence of membrane-anchored lipoproteins or presence of soluble variants

ChallengeTechnical SolutionAnalytical Approach
Growth defectsStandardize growth conditions, use defined mediaNormalize data to account for growth differences
Lipoprotein mislocalizationSubcellular fractionation, quantitative proteomicsCompare distribution patterns between compartments
Secondary mutationsWhole genome sequencing, multiple independent mutantsIdentify consistent vs. variable phenotypes
Functional redundancyDouble/triple mutants, overexpression studiesEpistasis analysis to uncover masked phenotypes
Host interaction complexityEx vivo systems with relevant immune cellsIsolate specific interaction mechanisms

Researchers should also be aware that blocked lipidation abolishes the bacteria's ability to activate TLR2 signaling , creating an immunologically distinct phenotype that may not reflect lipoprotein functional defects per se.

How should researchers approach contradictory results in lgt functional studies?

When facing contradictory results in lgt functional studies, researchers should implement a systematic approach:

Methodological Evaluation:

  • Examine differences in experimental conditions (media, growth phase, temperature)

  • Compare strain backgrounds and genetic constructs used across studies

  • Assess technical approaches and their limitations

  • Evaluate statistical methods and sample sizes for adequate power

Contradictions often arise from subtle differences in experimental systems rather than fundamental biological discrepancies. For example, the relationship between lgt mutation and TLR2 activation might appear contradictory in different studies due to varying levels of other TLR2 ligands present in experimental systems.

Source of ContradictionDiagnostic ApproachResolution Strategy
Strain background differencesSequence comparison, phenotypic profilingRepeat experiments in identical genetic backgrounds
Growth condition variationsSystematic condition testingStandardize protocols across laboratories
Assay sensitivity differencesCalibration with standardsUse multiple complementary assays
Technical variabilityIncrease replication, blind analysisCollaborative cross-validation between laboratories

When contradictory results persist despite methodological standardization, researchers should consider the possibility that lgt function may be context-dependent. Designing experiments that specifically test for conditional effects can transform apparent contradictions into a more nuanced understanding of lgt biology.

What bioinformatic approaches best support research on lgt evolution and diversity?

Bioinformatic approaches for studying lgt evolution and diversity should combine sequence analysis, structural prediction, and comparative genomics:

Sequence Analysis Tools:

  • Multiple Sequence Alignment (MSA) software (MUSCLE, MAFFT) to align lgt sequences across bacterial species

  • Phylogenetic analysis tools (RAxML, IQ-TREE) to reconstruct evolutionary relationships

  • Selection analysis software (PAML, HyPhy) to detect signatures of selection pressure

Comparative Genomics Approaches:
For effective analysis of lgt in the context of bacterial evolution, researchers should examine:

  • Genomic context conservation around lgt genes

  • Presence of mobile genetic elements or recombination signatures

  • Correlation between lgt sequence variants and phenotypic traits

Analysis ObjectiveRecommended ToolsOutput DataInterpretation Guidelines
Evolutionary historyIQ-TREE, BEASTPhylogenetic trees, divergence timesCompare with species tree, look for incongruence
Lateral gene transfer detectionAlien_Hunter, HGT-FinderPotential HGT regions, statistical scoresMultiple lines of evidence strengthen LGT claims
Selection pressure analysisPAML (codeml), MEMEdN/dS ratios, sites under selectionValues >1 suggest positive selection
Structural impact predictionAlphaFold, SWISS-MODELProtein structure modelsMap sequence variations to functional domains

When analyzing sequence data across K. pneumoniae strains, researchers should be particularly attentive to recombination events, as these have been shown to play important roles in the evolution of high-risk clones . The molecular evolution of K. pneumoniae strains, particularly the predominant KPC-associated CRKP clone in China (ST11), has been shaped by recombination events affecting surface structures .

What are the key knowledge gaps in our understanding of lgt function in K. pneumoniae?

Despite significant advances in understanding lgt function, several knowledge gaps remain that present opportunities for future research. The precise mechanisms by which lgt mutation attenuates virulence beyond TLR2 signaling effects remain incompletely characterized. Additionally, the relationship between lgt function and the evolution of antibiotic resistance, particularly in carbapenem-resistant K. pneumoniae, requires further investigation .

The role of lgt in bacterial adaptation to different host environments and stress conditions represents another area needing exploration. While we know that blocking lipidation by mutating lgt de-anchors lipoproteins from the cell surface , the comprehensive consequences of this alteration across different growth conditions and infection scenarios remain to be fully elucidated.

Developing improved methods for studying lgt function in the context of complex host-pathogen interactions will be essential for advancing our understanding of this important bacterial enzyme. Bridging these knowledge gaps will contribute to a more complete understanding of K. pneumoniae pathogenesis and potentially reveal new approaches for therapeutic intervention.

How might future research on lgt contribute to addressing antimicrobial resistance?

The worldwide spread of carbapenem-resistant Klebsiella pneumoniae, particularly high-risk clones like ST11 in China , highlights the urgent need for new approaches to combat antimicrobial resistance. Future research on lgt could contribute significantly to this effort through several avenues:

  • Novel therapeutic targets: As a key enzyme in lipoprotein processing, lgt represents a potential target for novel antimicrobials. Inhibitors that selectively target bacterial lgt could disrupt multiple virulence and survival mechanisms simultaneously.

  • Vaccine development: Understanding how lgt affects lipoprotein presentation could inform the development of vaccines targeting K. pneumoniae surface structures. The significant immunomodulatory effects of lipoproteins as TLR2 ligands suggest they might serve as effective vaccine components or adjuvants.

  • Resistance mechanism insights: Further investigation of the relationship between lgt function and antibiotic resistance mechanisms may reveal unexpected connections and novel intervention strategies.

  • Evolutionary monitoring: Tracking lgt sequence variation and expression patterns across emerging resistant strains could provide early indicators of adaptive changes affecting virulence or resistance profiles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.