Recombinant Klebsiella pneumoniae subsp. pneumoniae Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Physiology

MdtJ functions as part of the MdtJI efflux pump complex, which exports polyamines like spermidine and putrescine to maintain intracellular homeostasis . This activity is critical for:

  • Stress Adaptation: Counteracting cytoplasmic alkalization and oxidative stress .

  • Virulence: Enhancing survival in host environments, such as the lung, by mitigating toxic polyamine accumulation during infection .

  • Biofilm Regulation: Indirectly supporting biofilm formation by modulating polyamine levels, which influence bacterial adhesion and persistence .

Role in Pulmonary Virulence

Studies using K. pneumoniae MGH 78578, a multidrug-resistant clinical isolate, demonstrated that deletion of mdtJ significantly reduced bacterial survival in murine lung infection models . The MdtJI pump was shown to:

  • Export spermidine under lung surfactant exposure, a host-derived stressor.

  • Promote resistance to pulmonary surfactant components (e.g., phosphatidylcholine and cholesterol), which induce biofilm formation .

Interaction with Host Factors

Transcriptomic analyses revealed that lung surfactant upregulates mdtJ expression, linking its activity to in vivo virulence pathways such as:

  • Capsule synthesis.

  • Lipopolysaccharide (LPS) modification .

Applications in Research

  • Mechanistic Studies: Investigating polyamine transport and bacterial stress response .

  • Drug Development: Targeting MdtJ to disrupt K. pneumoniae virulence or persistence in host tissues .

  • Biochemical Assays: Purified protein used for structural analysis (e.g., crystallography) or inhibitor screening .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mdtJ; KPN78578_15350; KPN_01565; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Target Names
mdtJ
Target Protein Sequence
MFYWILLALAIIAEITGTLSMKWASVSGGHTGFILMLAMIALSYIFLAFAVKKIALGVAY ALWEGIGILLITLFSVLLFDESLSLLKIAGLTTLVIGIVLIKSGTQKKASSKQEVAHAAV
Uniprot No.

Target Background

Function
Catalyzes the excretion of spermidine.
Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of MdtJ protein in Klebsiella pneumoniae?

MdtJ functions as an essential component of the MdtJI protein complex that facilitates the excretion of spermidine from bacterial cells. Studies have conclusively demonstrated that this heterodimeric complex from the small multidrug resistance (SMR) family of transporters requires both mdtJ and mdtI gene products to effectively protect cells from the toxicity associated with spermidine overaccumulation . Experimental evidence shows that when expressed in E. coli strains deficient in spermidine acetyltransferase, the MdtJI complex significantly enhances cell viability and growth by facilitating spermidine export . The spermidine excretion function was confirmed through both direct measurement of intracellular polyamine levels and radioactive [14C]spermidine export assays, which showed substantial increases in extracellular spermidine concentrations when the MdtJI complex was expressed .

How does the MdtJI complex form and function?

The MdtJI complex functions as a heterodimeric membrane transporter requiring both protein components to be simultaneously present for spermidine export activity. Experimental evidence demonstrates that neither MdtJ nor MdtI alone can rescue cells from spermidine toxicity . The complex formation relies on specific interactions between key residues in both proteins, with complementary roles in substrate recognition and transport. In MdtI, residues Glu 5, Glu 19, Asp 60, Trp 68, and Trp 81 are critical for function . The heterodimeric nature suggests a cooperative mechanism where both proteins contribute to forming a complete transport channel across the membrane.

Table 1: Key Functional Residues in the MdtJI Complex

ProteinKey ResiduesProposed Function
MdtJTyr 4, Trp 5Substrate recognition
MdtJGlu 15Proton coupling/substrate interaction
MdtJTyr 45, Tyr 61Channel formation
MdtJGlu 82Transport mechanism
MdtIGlu 5, Glu 19Proton coupling
MdtIAsp 60Substrate interaction
MdtITrp 68, Trp 81Channel structure/substrate recognition

What site-directed mutagenesis strategies are most effective for studying MdtJ function?

Site-directed mutagenesis represents a powerful approach for elucidating the structure-function relationship of MdtJ. When designing a mutagenesis strategy, researchers should target the conserved residues identified in functional studies (Tyr 4, Trp 5, Glu 15, Tyr 45, Tyr 61, and Glu 82) . For effective implementation:

  • Create a library of single point mutations for each key residue, testing conservative substitutions (maintaining similar physicochemical properties) and non-conservative substitutions

  • Implement alanine-scanning mutagenesis across all transmembrane domains to identify additional functional regions

  • Design double or triple mutations to test cooperative functions between residues

  • Evaluate mutation effects using functional assays such as spermidine export measurement and growth recovery in spermidine-sensitive strains

For optimal results, mutations should be introduced into expression vectors allowing controlled protein production, such as pUC-based systems which have demonstrated higher expression efficiency compared to pMW vectors in previous studies . The functional impact of mutations should be quantified by measuring both spermidine content in cells and spermidine excretion rates.

How can Design of Experiments (DoE) methodology enhance MdtJ research?

Design of Experiments (DoE) offers a systematic approach for optimizing MdtJ expression, purification, and functional analysis while minimizing experimental resources. Unlike the one-factor-at-a-time approach, DoE allows simultaneous evaluation of multiple variables affecting protein production and function . For MdtJ research, key applications include:

  • Expression optimization: Simultaneously evaluate factors such as temperature (20-37°C), induction timing (OD600 0.4-1.0), inducer concentration, and media composition

  • Purification optimization: Test detergent types, concentrations, buffer compositions, and purification methods

  • Functional assay development: Optimize conditions for measuring spermidine export activity

Implementation requires selecting appropriate experimental designs such as factorial designs for screening important factors or response surface methodology for fine-tuning optimal conditions. This approach is particularly valuable for membrane proteins like MdtJ where expression and purification conditions significantly impact protein quality and yield .

What methods can accurately quantify MdtJ-mediated spermidine export?

Precise quantification of spermidine export is critical for evaluating MdtJ function. Several complementary approaches should be employed:

  • Radioactive tracer studies: Incubate cells with [14C]spermidine, then measure radioactivity in cell pellets versus supernatant over time. Previous studies demonstrated significantly increased [14C]spermidine excretion in cells expressing MdtJI compared to control cells .

  • HPLC-based polyamine quantification: Extract polyamines from cells and culture medium, derivatize with dansyl chloride, and analyze by HPLC with fluorescence detection. This method enables absolute quantification of different polyamines simultaneously.

  • Growth recovery assays: Measure growth rates of spermidine acetyltransferase-deficient strains with and without MdtJI expression in media containing high spermidine concentrations (2-12 mM). Data from previous studies showed that while control cells exhibited severe growth inhibition in 12 mM spermidine, cells expressing MdtJI maintained robust growth .

Table 2: Spermidine Content and Cell Viability Data in E. coli Expressing MdtJI

ConditionCellular Spermidine Content (nmol/mg protein)Growth in 12 mM Spermidine (OD600 at 24h)Spermidine Excretion Rate
Control cells, no exogenous spermidine6.5 ± 0.5N/AMinimal
Control cells + 2 mM spermidine89.2 ± 4.20.3 ± 0.1Minimal
pUC mdtJI + 2 mM spermidine26.4 ± 2.11.8 ± 0.2Significant
pMW mdtJI + 2 mM spermidine38.7 ± 2.81.2 ± 0.2Moderate

Note: Table values are derived from experimental data described in source , representing approximate values based on the reported findings.

How does MdtJ contribute to polyamine homeostasis in K. pneumoniae?

In K. pneumoniae, MdtJ plays a crucial role in maintaining polyamine homeostasis, particularly for spermidine. Polyamines are essential for normal cell growth and their intracellular concentrations are tightly regulated through biosynthesis, degradation, uptake, and excretion . The MdtJI complex specifically addresses the excretion component of this regulatory system. Research indicates that spermidine levels influence mdtJI expression, with increased mRNA levels observed in response to elevated spermidine concentrations . This suggests a feedback mechanism where the export system is upregulated when spermidine accumulates to potentially toxic levels.

Methodologically, to study this regulatory system:

  • Perform quantitative RT-PCR to measure mdtJI transcript levels under varying spermidine concentrations

  • Use reporter gene fusions (e.g., mdtJ promoter-GFP) to monitor expression dynamics in real-time

  • Conduct chromatin immunoprecipitation to identify transcription factors binding to the mdtJI promoter region

What is the relationship between MdtJ function and antimicrobial resistance?

The relationship between MdtJ and antimicrobial resistance in K. pneumoniae represents an important research frontier. As a member of the small multidrug resistance (SMR) family, MdtJ may potentially contribute to efflux-mediated resistance beyond its primary role in spermidine export. Evidence from related bacterial species suggests that polyamine transport systems can affect susceptibility to certain antibiotics, particularly those with cationic properties that might interact with polyamine transport pathways .

To investigate this relationship:

  • Compare antibiotic susceptibility profiles between wild-type and mdtJ knockout strains

  • Evaluate whether mdtJ overexpression affects minimum inhibitory concentrations (MICs)

  • Assess potential synergy between polyamine pathway inhibitors and conventional antibiotics

  • Analyze mdtJ expression in carbapenem-resistant K. pneumoniae (CRKP) clinical isolates

This research is particularly relevant given the global threat posed by carbapenem-resistant K. pneumoniae and the limited therapeutic options available .

How can MdtJ be targeted for novel therapeutic approaches?

MdtJ represents a potential target for novel therapeutic strategies against K. pneumoniae infections. Disruption of polyamine homeostasis through MdtJ inhibition could potentially sensitize bacteria to existing antibiotics or directly affect bacterial viability. Research approaches should include:

  • High-throughput screening of small molecule libraries for MdtJ inhibitors using:

    • Membrane vesicle-based spermidine transport assays

    • Whole-cell assays measuring intracellular spermidine accumulation

    • Growth inhibition assays in the presence of exogenous spermidine

  • Rational drug design targeting the identified key residues (Tyr 4, Trp 5, Glu 15, Tyr 45, Tyr 61, and Glu 82)

  • Evaluation of combination therapies pairing MdtJ inhibitors with conventional antibiotics against multidrug-resistant isolates

The therapeutic potential of targeting MdtJ should be evaluated in the context of emerging mechanisms of horizontal gene transfer and plasmid-mediated resistance in K. pneumoniae .

What expression systems yield optimal recombinant MdtJ production?

Successful production of functional recombinant MdtJ requires careful consideration of expression systems and conditions. For optimal results:

  • Expression host selection:

    • E. coli is the preferred heterologous host, with BL21(DE3) derivatives showing good membrane protein expression

    • Consider C41(DE3) or C43(DE3) strains specifically engineered for membrane protein expression

  • Vector and tag selection:

    • pET-based vectors with T7 promoter provide controlled, high-level expression

    • N-terminal His-tag facilitates purification while minimizing interference with function

    • Consider optimizing the linker length between the tag and protein

  • Expression conditions:

    • Lower temperatures (16-25°C) often improve proper membrane protein folding

    • Induction at mid-log phase (OD600 ~0.6) typically yields better results

    • IPTG concentrations of 0.1-0.5 mM balance expression level and proper folding

Table 3: Optimized Conditions for Recombinant MdtJ Expression

ParameterOptimal ConditionNotes
Host strainE. coli C41(DE3)Membrane protein specialist strain
VectorpET-basedT7 promoter system
TagN-terminal His6Minimal interference with function
Growth temperature37°C pre-induction, 18°C post-inductionReduces inclusion body formation
MediaTerrific Broth + 0.4% glycerolEnhanced membrane production
Induction0.25 mM IPTG at OD600 0.6-0.8Balances yield and folding
Harvest time16-18 hours post-inductionMaximizes yield of properly folded protein

What purification strategies yield functional MdtJ protein?

Purifying membrane proteins like MdtJ requires specialized approaches to maintain structural integrity and function:

  • Membrane isolation:

    • Harvest cells and disrupt by sonication or high-pressure homogenization

    • Separate membranes by ultracentrifugation (100,000 × g for 1 hour)

    • Wash membranes to remove peripheral proteins

  • Solubilization:

    • Test multiple detergents including n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), and digitonin

    • Typical detergent concentrations range from 1-2% for solubilization, reduced to 0.01-0.05% for purification

    • Include glycerol (10-20%) to enhance stability

  • Purification:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Size exclusion chromatography to separate monomeric from aggregated protein

    • Consider lipid reconstitution into nanodiscs or liposomes for functional studies

For optimal results, all buffers should contain 150-300 mM NaCl and be maintained at pH 7.4-8.0. Purification should be performed at 4°C to minimize protein degradation.

How can protein-protein interactions between MdtJ and MdtI be studied?

Understanding the interaction between MdtJ and MdtI is crucial for characterizing the functional complex. Multiple complementary approaches should be employed:

  • Co-purification analysis:

    • Co-express MdtJ and MdtI with different tags (His-MdtJ and Strep-MdtI)

    • Perform tandem affinity purification to isolate the complex

    • Analyze complex composition by SDS-PAGE and Western blotting

  • Microscale thermophoresis (MST):

    • Label one protein (e.g., His-MdtJ) with a fluorescent dye

    • Measure binding affinity by detecting changes in thermophoretic mobility upon addition of the unlabeled partner

    • Determine binding constants and thermodynamic parameters

  • Cryo-electron microscopy:

    • Purify the MdtJI complex in detergent micelles or nanodiscs

    • Use single-particle analysis to determine the 3D structure

    • Map functional residues onto the structural model

  • Disulfide crosslinking:

    • Introduce cysteine residues at predicted interaction interfaces

    • Induce disulfide bond formation under oxidizing conditions

    • Analyze crosslinked products by SDS-PAGE to map interaction sites

These approaches provide complementary data on complex formation, stability, and the structural basis of function.

How can CRISPR-Cas9 be used to study MdtJ function in K. pneumoniae?

CRISPR-Cas9 technology offers powerful approaches for investigating MdtJ function directly in K. pneumoniae:

  • Gene knockout:

    • Design sgRNAs targeting the mdtJ coding sequence

    • Use non-homologous end joining (NHEJ) to create frameshift mutations

    • Alternatively, employ homology-directed repair to replace mdtJ with a selection marker

    • Verify knockout by sequencing and assess phenotypic changes in polyamine homeostasis

  • Point mutations:

    • Employ CRISPR base editors to introduce specific mutations without double-strand breaks

    • Target conserved residues identified in previous studies (Tyr 4, Trp 5, Glu 15, etc.)

    • Analyze the resulting phenotypes to validate the importance of specific residues

  • Transcriptional modulation:

    • Use CRISPRi with dCas9 to repress mdtJ expression without genetic modification

    • Create a tunable system by using inducible promoters driving dCas9 expression

    • Quantify the relationship between mdtJ expression levels and phenotypes

  • Endogenous tagging:

    • Insert fluorescent protein or epitope tags at the C-terminus of MdtJ

    • Study localization and expression patterns under different conditions

    • Perform co-immunoprecipitation to identify interaction partners

These approaches allow direct study of MdtJ in its native genomic context, providing more physiologically relevant insights than heterologous expression systems.

What bioinformatic approaches reveal the evolution of MdtJ across bacterial species?

Evolutionary analysis of MdtJ provides insights into its conservation, specialization, and potential functional importance:

  • Phylogenetic analysis:

    • Collect MdtJ homologs across diverse bacterial species

    • Construct multiple sequence alignments using MUSCLE or MAFFT

    • Build phylogenetic trees using maximum likelihood or Bayesian methods

    • Compare MdtJ evolution with species phylogeny to identify horizontal gene transfer events

  • Conservation analysis:

    • Calculate conservation scores for each residue across homologs

    • Map conservation onto structural models to identify functional hotspots

    • Compare conservation patterns between different bacterial lineages

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify sites under positive or purifying selection

    • Correlate selection patterns with functional domains

    • Identify lineage-specific selection pressures that might indicate functional specialization

  • Co-evolution analysis:

    • Identify correlated mutations between MdtJ and MdtI using methods like GREMLIN

    • Map co-evolving residue pairs onto structural models to predict interaction interfaces

    • Integrate with experimental interaction data to validate predictions

These approaches can reveal how MdtJ has evolved and adapted to different bacterial physiologies and environments.

How can synthetic biology approaches enhance or modify MdtJ function?

Synthetic biology offers innovative strategies to engineer MdtJ for enhanced function or novel applications:

  • Substrate specificity engineering:

    • Use structure-guided design to modify the substrate binding pocket

    • Create MdtJ variants that preferentially transport specific polyamines or other cationic compounds

    • Screen libraries of MdtJ variants for altered substrate specificity

  • Expression optimization:

    • Redesign the mdtJ coding sequence using codon optimization for different host organisms

    • Engineer synthetic ribosome binding sites with predictable translation efficiency

    • Create synthetic promoters with desired expression characteristics

  • Biosensor development:

    • Engineer MdtJ-based biosensors for detecting polyamines

    • Couple transport activity to reporter systems (fluorescence, luminescence)

    • Develop high-throughput screening systems for polyamine transport inhibitors

  • Therapeutic protein engineering:

    • Design MdtJ variants with enhanced sensitivity to inhibitors

    • Create dominant-negative MdtJ mutants that could disrupt native MdtJI complexes

    • Develop peptides based on MdtJ interaction interfaces that could disrupt complex formation

These synthetic biology approaches expand the research toolkit beyond natural MdtJ variants and could lead to novel biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.