Recombinant Klebsiella pneumoniae subsp. pneumoniae Sulfoxide reductase heme-binding subunit YedZ (yedZ)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant YedZ is a transmembrane flavocytochrome involved in sulfoxide reduction, a process linked to bacterial oxidative stress response and virulence . Key features include:

PropertyDetails
Gene NameyedZ (Locus: KPK_0455 in strain 342)
Protein LengthFull-length (1–202 amino acids in subsp. pneumoniae; 1–199 in strain 342)
Molecular Weight~84 kDa (theoretical, unmodified)
TagN-terminal 10xHis tag for purification
Expression SystemEscherichia coli (optimized for transmembrane protein production)
UniProt IDA6TES0 (subsp. pneumoniae); B5XNE5 (strain 342)

Functional Role

YedZ functions as a heme-binding subunit in sulfoxide reductase complexes, likely contributing to:

  • Redox homeostasis: Catalyzes sulfoxide reduction, mitigating oxidative damage .

  • Iron metabolism: Heme groups may interact with siderophores (e.g., yersiniabactin, aerobactin) linked to K. pneumoniae virulence .

  • Membrane integrity: Transmembrane structure suggests roles in electron transport across bacterial membranes .

Expression and Yield

  • Vector: pSUMO3 or proprietary plasmids for high-yield expression in E. coli .

  • Purification: Ni-NTA affinity chromatography achieves >95% purity .

  • Stability:

    • Liquid form: 6 months at -20°C/-80°C .

    • Lyophilized form: 12 months at -20°C/-80°C .

Activity Validation

  • Enzymatic assays: Confirmed sulfoxide reductase activity via spectrophotometric methods .

  • Structural analysis: Alpha-helical Rossmann fold observed in homologs (e.g., E. coli YedZ) .

Biochemical Studies

  • Substrate specificity: Binds heme and sulfoxides with high affinity .

  • Inhibitor screening: Used to identify compounds targeting redox pathways in multidrug-resistant K. pneumoniae .

Therapeutic Potential

  • Antibiotic adjuvants: Depolymerase-like enzymes (e.g., K19-Dpo41) show synergy with serum components to enhance bacterial clearance .

  • Vaccine development: Surface-exposed epitopes of YedZ may serve as antigenic targets .

Comparative Analysis of Recombinant Variants

ParameterK. pneumoniae subsp. pneumoniae K. pneumoniae strain 342
Amino Acid Range1–2021–199
Tag PositionN-terminalN-terminal
Purity>95% (SDS-PAGE)>95% (SDS-PAGE)
Host AdaptationClinical isolateEnvironmental isolate

Challenges and Future Directions

  • Structural flexibility: Molecular dynamics simulations reveal dynamic substrate-binding regions, complicating inhibitor design .

  • Pathogenicity links: Further studies needed to correlate YedZ activity with K. pneumoniae virulence in vivo .

  • Industrial scaling: Optimizing transmembrane protein yields in E. coli remains technically challenging .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
msrQ; KPN78578_36300; KPN_03662; Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ; Flavocytochrome MsrQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Target Names
msrQ
Target Protein Sequence
MRFTVKQIVWLKVLLHLAGFLPLVWLFWAGHQGYFSADPAKDIQHFTGRMALKFLLATLL VSPLARYAKQPLLIRVRRLLGLWCFAWATLHLTSYTLLELGINNLALLGSEIITRPYLTL GMISWAILLALAVTSTQAMQRKLGRRWQLLHNFVYLVAILAPIHYLWSVKIVSPQPVVYA LLAAGLLTWRYKKFRQWWRAIR
Uniprot No.

Target Background

Function
YedZ, part of the MsrPQ system, repairs oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O) by utilizing respiratory chain electrons. This process protects these proteins from oxidative-stress damage caused by reactive oxygen and chlorine species generated by host defense mechanisms. MsrPQ plays a vital role in maintaining envelope integrity under bleach stress, rescuing a diverse range of structurally unrelated periplasmic proteins from methionine oxidation. MsrQ provides electrons for reduction to the reductase catalytic subunit MsrP, utilizing the quinone pool of the respiratory chain.
Database Links
Protein Families
MsrQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of YedZ in Klebsiella pneumoniae?

YedZ in Klebsiella pneumoniae is a membrane-bound heme-binding subunit of the sulfoxide reductase complex. The protein contains a single heme b cofactor coordinated by two histidine residues and spans the cytoplasmic membrane with six transmembrane helices. The protein's tertiary structure facilitates electron transfer from quinones to the catalytic subunit of the complex. Research approaches typically employ X-ray crystallography, cryo-electron microscopy, or computational modeling to elucidate its structure. When expressing recombinant YedZ, researchers must account for its membrane localization by using appropriate detergents during purification.

How does the expression of YedZ differ between classical and hypervirulent strains of Klebsiella pneumoniae?

Expression levels of YedZ vary significantly between classical and hypervirulent strains of K. pneumoniae. In hypervirulent strains, YedZ expression is typically upregulated during infection, potentially contributing to oxidative stress resistance. Recent studies have identified genetic elements that transform classical K. pneumoniae into hypervirulent strains, which may affect YedZ regulation . When investigating these differences, researchers should employ qRT-PCR to quantify yedZ transcript levels and Western blotting to compare protein expression across different strain backgrounds, particularly between clinical isolates that demonstrate varying degrees of virulence.

What experimental systems are recommended for heterologous expression of recombinant YedZ?

For heterologous expression of recombinant YedZ, the following expression systems have demonstrated optimal results:

Researchers should optimize expression conditions including temperature (typically 18-25°C), induction parameters (0.1-0.5 mM IPTG for E. coli systems), and harvest timing (4-16 hours post-induction). Addition of δ-aminolevulinic acid (0.5 mM) as a heme precursor often improves functional protein yield.

How can researchers distinguish between YedZ function in genomic hybrids of K. pneumoniae and K. variicola?

Distinguishing YedZ function in genomic hybrids requires comprehensive genomic and functional analyses. Recent studies have identified K. variicola/K. pneumoniae hybrids where large recombination events have occurred, particularly affecting capsular biosynthesis loci . To investigate YedZ in these hybrid contexts:

  • Begin with whole-genome sequencing to identify the exact genomic background of the yedZ gene.

  • Perform comparative genomics to determine whether yedZ originated from K. pneumoniae or K. variicola.

  • Conduct enzyme kinetic assays comparing recombinant YedZ from both parental species and the hybrid strain.

  • Measure sulfoxide reductase activity under various oxidative stress conditions.

Gene knockout and complementation experiments are essential to attribute functional differences specifically to YedZ rather than other genetic elements in the hybrid background. Researchers should be particularly attentive to sequence variations in the heme-binding pocket that may alter catalytic efficiency.

What role might YedZ play in antimicrobial resistance mechanisms in ESBL-producing K. pneumoniae strains?

YedZ's potential role in antimicrobial resistance mechanisms is multifaceted. In ESBL-producing strains, oxidative stress response pathways involving sulfoxide reductases may contribute to bacterial survival during antibiotic exposure. ESBL-positive strains show significantly higher nosocomial transmission rates (28%) compared to ESBL-negative strains (1.7%) , suggesting enhanced fitness potentially involving stress response systems.

Investigation approaches should include:

  • Transcriptomic profiling to identify co-regulation patterns between yedZ and resistance genes

  • Creation of yedZ knockout mutants in ESBL-producing strains to assess changes in minimum inhibitory concentrations

  • Measurement of reactive oxygen species accumulation during antibiotic challenge in wild-type versus yedZ-mutant strains

  • Complementation studies using site-directed mutagenesis of key YedZ residues to identify critical functional domains

Researchers should analyze these parameters across clinical isolates with different resistance profiles to establish correlations between YedZ function and specific resistance mechanisms.

How can Bayesian optimal experimental design improve investigation of YedZ's role in causal networks related to K. pneumoniae virulence?

Applying Bayesian optimal experimental design (OED) can significantly enhance research efficiency when investigating YedZ's role in virulence networks. This approach minimizes the expected posterior entropy as rapidly as possible, allowing researchers to select interventions that yield maximum information about the system .

Implementation strategy for YedZ research:

  • Establish prior probabilities for YedZ interactions with virulence factors based on existing literature

  • Design sequential experiments targeting specific nodes in the causal network

  • Update the posterior distribution after each experiment

  • Select subsequent interventions based on minimizing expected posterior entropy

The key advantage of this approach is computational efficiency - researchers can implement it using simple summaries of the current posterior without performing posterior inference on hypothetical future datasets . When investigating YedZ's role in virulence networks, this allows for optimal selection of gene knockout combinations, environmental conditions, or infection models that will most efficiently elucidate the causal structure.

What purification protocols are most effective for obtaining functional recombinant YedZ protein?

Purification of functional recombinant YedZ requires specialized protocols that maintain membrane protein integrity. The following optimized protocol yields high-purity, functionally active protein:

  • Cell lysis: Use gentle mechanical disruption (French press at 15,000 psi) in buffer containing 50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10% glycerol, and protease inhibitors

  • Membrane extraction: Solubilize membranes with 1% n-dodecyl-β-D-maltoside (DDM) for 1 hour at 4°C

  • Affinity chromatography: Apply solubilized fraction to Ni-NTA resin (for His-tagged constructs)

  • Washing: Remove contaminants with 20-40 mM imidazole while maintaining 0.05% DDM

  • Elution: Recover protein with 250-300 mM imidazole

  • Size exclusion: Further purify via gel filtration using Superdex 200 column

Activity assessment should include UV-visible spectroscopy to confirm proper heme incorporation (characteristic absorption peaks at 410-415 nm for oxidized and 425-430 nm for reduced forms) and sulfoxide reductase activity assays using model substrates such as dimethyl sulfoxide or methionine sulfoxide.

How should researchers design experiments to investigate YedZ function under conditions mimicking infection environments?

Designing experiments that recapitulate infection environments requires careful consideration of physiological conditions. To investigate YedZ function in these contexts:

  • Establish growth conditions that mimic infection sites:

    • Lung infection: Reduced oxygen (5-10%), elevated CO2 (5%), host cell debris, mucin

    • Urinary tract: Acidic pH (5.5-6.5), high osmolarity, urea

    • Bloodstream: Serum-supplemented media, physiological pH, presence of immune factors

  • Monitor YedZ expression and activity with the following parameters:

    • Host-derived oxidative stress (H2O2, superoxide, HOCl)

    • Nutrient limitation, particularly iron restriction

    • Presence of antimicrobial peptides

  • Employ relevant model systems:

    • Cell culture: Human epithelial or macrophage co-culture systems

    • Ex vivo: Organ tissue culture models

    • In vivo: Murine infection models with tissue-specific analysis

Researchers should incorporate transcriptomic and proteomic analyses to identify co-regulated networks and post-translational modifications affecting YedZ function during infection. Time-course experiments are essential to capture the dynamic nature of YedZ's role throughout the infection process.

What analytical techniques provide the most comprehensive assessment of YedZ's contribution to bacterial fitness?

A comprehensive assessment of YedZ's contribution to bacterial fitness requires integration of multiple analytical approaches:

TechniqueInformation ProvidedTechnical Considerations
Competitive fitness assaysDirect measurement of relative fitness advantage/disadvantageRequires distinguishable markers in wild-type vs. mutant strains
Transposon sequencing (Tn-seq)Genome-wide fitness contribution in various conditionsHigh sequencing depth required for statistical power
MetabolomicsChanges in sulfoxide metabolism and related pathwaysCareful sample preparation to avoid oxidation artifacts
Hydrogen peroxide survival assaysDirect measure of oxidative stress resistanceStandardized culture conditions critical for reproducibility
Galleria mellonella infection modelIn vivo fitness and virulence assessmentTemperature control essential (37°C)

Integration of these approaches provides a systems-level understanding of YedZ's role. Researchers should also consider epistasis experiments combining yedZ mutations with other oxidative stress response genes to map functional networks. When performing these analyses in hypervirulent strains, particular attention should be paid to interactions with virulence plasmid-encoded features, which are predominantly found in community-onset cases .

How might YedZ function interface with hypervirulent K. pneumoniae metabolism and stress response?

The emerging hypervirulent strains of K. pneumoniae represent a particular concern for public health due to their ability to cause severe infections in otherwise healthy individuals . Future research should explore how YedZ interfaces with metabolic adaptations specific to hypervirulent strains. Key investigation areas include:

  • Comparative metabolomic profiling of wild-type and yedZ mutants in hypervirulent versus classical strains

  • Assessment of YedZ activity during exposure to host-derived oxidative stress

  • Evaluation of potential interactions between YedZ and hypervirulence-associated plasmid-encoded factors

  • Investigation of YedZ's role in regulating central carbon metabolism during infection

These studies will provide crucial insights into how YedZ might contribute to the enhanced virulence and tissue invasiveness characteristic of hypervirulent K. pneumoniae strains that have been labeled as "true and dreaded superbugs" .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.