Recombinant Klebsiella pneumoniae subsp. pneumoniae Thiol:disulfide interchange protein DsbD (dsbD)

Shipped with Ice Packs
In Stock

Description

Introduction

Thiol:disulfide interchange proteins are critical for bacterial oxidative protein folding, particularly in the periplasmic space. DsbD, a redox enzyme in Klebsiella pneumoniae, facilitates electron transfer between cytoplasmic thioredoxin and periplasmic substrates, ensuring proper disulfide bond formation in virulence factors and membrane proteins. Recombinant DsbD enables detailed biochemical and structural studies to explore its role in bacterial pathogenesis and antibiotic resistance.

Protein Composition

DsbD is a membrane-bound oxidoreductase with three domains:

  • N-terminal domain: Transmembrane helix for anchoring.

  • Central domain: Mediates electron transfer via two cysteine pairs.

  • C-terminal domain: Interacts with downstream substrates like DsbC/DsbG.

Homologs in K. pneumoniae share >80% sequence identity with Escherichia coli DsbD, suggesting conserved redox mechanisms .

Recombinant Production

Recombinant DsbD is typically expressed in E. coli with an N-terminal His tag for purification. Key parameters include:

ParameterDetails
Expression HostEscherichia coli BL21(DE3)
TagPolyhistidine (His-tag)
PurificationImmobilized metal affinity chromatography (IMAC)
Molecular Weight~65 kDa (predicted)
StorageLyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0) at -80°C

Virulence Factor Maturation

DsbD is essential for folding virulence-associated proteins, including:

  • Outer membrane proteins (OMPs): OmpA and OmpK36, critical for immune evasion .

  • Siderophores: Aerobactin and yersiniabactin, required for iron acquisition .

  • Toxin-antitoxin systems: Stabilizes colibactin and phospholipase D (PLD1) .

Mutants lacking dsbD show attenuated virulence in murine infection models .

Antibiotic Resistance Modulation

DsbD supports the activity of β-lactamases (e.g., KPC-2, NDM-1) and efflux pumps by ensuring proper disulfide bonding. Chemical inhibition of DsbD disrupts:

  • β-lactamase stability: Reduces hydrolysis of carbapenems and cephalosporins .

  • Efflux pump assembly: Compromises multidrug resistance (MDR) phenotypes .

Therapeutic Implications

  • Antibiotic adjuvants: DsbD inhibitors (e.g., phenylthiophene carboxylates) restore susceptibility to β-lactams in carbapenem-resistant K. pneumoniae .

  • Vaccine development: Recombinant OmpK36 (dependent on DsbD for folding) elicits cross-protective immunity in murine models .

Comparative Genomics

Phylogenetic analysis reveals dsbD is conserved across K. pneumoniae clonal groups (CGs), including high-risk MDR lineages (ST258, ST147) . Notable features:

Clonal GroupAssociated Resistance/VirulencedsbD Sequence Variants
ST258KPC-2 carbapenemase, hypermucoviscosityNone reported
ST147NDM-1 metallo-β-lactamase, biofilm formationMissense mutation (G52K)
ST11ESBLs, colistin resistanceFrameshift in promoter

Challenges and Future Directions

  • Structural resolution: Full-length DsbD structures remain elusive due to transmembrane complexity.

  • Host-pathogen interactions: DsbD’s role in modulating host immune responses (e.g., HIF-1α activation) is underexplored .

  • Inhibitor optimization: Current DsbD-targeting compounds lack pharmacokinetic stability .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please specify it during the order process, and we will prioritize development of the requested tag.
Synonyms
dsbD; KPN78578_44560; KPN_04526; Thiol:disulfide interchange protein DsbD; Protein-disulfide reductase; Disulfide reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-598
Protein Length
Full Length of Mature Protein
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Target Names
dsbD
Target Protein Sequence
GLFDAPGRSNFVPADQAFAFDFQQQQHDVNLSWQIKDGYYLYRQQFTFSAAGATIDEPAL PAGEWHEDEFYGKSEIFRQRLTVPVTVKEADKEATLTVTWQGCADAGFCYPPETKVIPLS AVRAASNDGQATAIEPMPSTSSRPAFNPPLPVEPRPAPELATSPAPAAVPPADTPARLPF TALWALLIGIGIAFTPCVLPMYPLISGIVLGGKQRLSTARALLLAFIYVQGMALTYTALG LVVAAAGLQFQAALQHPYVLVGLSAVFILLALSMFGLFTLQLPSSLQTRLTLLSNKRQGG SPGGVFAMGAIAGLICSPCTTAPLSAILLYIAQSGNLWLGGGTLYLYALGMGLPLILMTV FGNRLLPKSGPWMSHVKTAFGFVILALPVFLLERILGDQWGLRLWSMLGVAFFSWAFITS LGATRPWMRLVQIILLAAALVSARPLQDWAFGAPAVEQQAHLAFTRVSSVAELDQALAQA KGQPVMLDLYADWCVACKEFEKYTFSSPDVQQALKGTVLLQVDVTKNSPQDVALLKHLQV LGLPTILFFNAEGQEQSERRVTGFMDAAAFSAHLRDWQA
Uniprot No.

Target Background

Function
Thiol:disulfide interchange protein DsbD (DsbD) is essential for facilitating the formation of correct disulfide bonds in certain periplasmic proteins and for the assembly of periplasmic c-type cytochromes. It functions by transferring electrons from cytoplasmic thioredoxin to the periplasm. This transfer involves a cascade of disulfide bond formation and reduction steps.
Database Links
Protein Families
Thioredoxin family, DsbD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of DsbD in Klebsiella pneumoniae?

DsbD (Disulfide bond formation protein D) in K. pneumoniae is a critical membrane protein involved in maintaining proper redox homeostasis in the bacterial periplasm. It functions primarily as an electron transporter, transferring reducing equivalents from the cytoplasmic thioredoxin system to various periplasmic oxidoreductases. In K. pneumoniae, DsbD plays an essential role in the disulfide bond isomerization pathway, allowing for the correction of non-native disulfide bonds in periplasmic and secreted proteins. This function is particularly important for the proper folding of virulence factors, including components of secretion systems, adhesins, and enzymes involved in capsule formation . The protein contains multiple domains with conserved cysteine residues that form a redox-active relay system for electron transfer across the cytoplasmic membrane .

How is the DsbD protein structured in K. pneumoniae?

The DsbD protein in K. pneumoniae is a large transmembrane protein (approximately 550-600 amino acids) with a complex multi-domain structure. The protein is composed of three distinct functional domains:

  • An N-terminal periplasmic domain (nDsbD) with a thioredoxin-like fold containing a CXXC active site motif

  • A central transmembrane domain (tDsbD) comprising 8-10 membrane-spanning helices with conserved cysteine residues

  • A C-terminal periplasmic domain (cDsbD) also containing a thioredoxin-like fold with a CXXC motif

This tripartite structure enables electron transfer from cytoplasmic thioredoxin through the membrane to periplasmic substrate proteins. The transmembrane segment acts as a conduit for electrons, while the periplasmic domains interact with various substrate proteins involved in disulfide bond formation and isomerization . The conserved cysteine residues in each domain form a relay system that allows sequential disulfide exchange reactions, facilitating the directional transfer of reducing power.

What expression systems are most effective for producing recombinant K. pneumoniae DsbD?

For effective expression of recombinant K. pneumoniae DsbD, researchers should consider the following optimized expression systems and conditions:

Expression SystemAdvantagesConsiderationsRecommended Conditions
E. coli C41(DE3) or C43(DE3)Designed for membrane proteins; reduces toxicityLower yields than standard strains18-20°C induction, 0.1-0.2 mM IPTG
E. coli Lemo21(DE3)Tunable expression level; good for toxic proteinsRequires optimization of rhamnose levels0.5-2.0 mM rhamnose, 16-20°C induction
Bacterial cell-free systemsAvoids toxicity issues; direct membrane incorporationHigher cost; specialized equipmentSupplement with nanodiscs or liposomes
Domain-specific expressionHigher yields for individual domainsNot suitable for functional studies of full proteinStandard BL21(DE3) for soluble domains

For full-length DsbD, expression should be conducted at low temperatures (16-20°C) after induction with reduced concentrations of inducer to minimize toxicity and protein aggregation. Including membrane-stabilizing additives such as glycerol (5-10%) and gentle detergents during cell lysis improves yield. For structural studies of individual domains, nDsbD and cDsbD can be expressed independently with higher yields, while the transmembrane domain requires specialized membrane protein expression systems .

What are the optimal purification strategies for recombinant DsbD?

Purification of recombinant DsbD requires specialized approaches due to its membrane protein nature. An optimized multi-step purification protocol includes:

  • Membrane fraction isolation:

    • Cell disruption via French press or sonication in buffer containing protease inhibitors

    • Sequential centrifugation steps (10,000×g to remove debris, then 100,000×g to collect membranes)

    • Resuspension of membrane fraction in solubilization buffer

  • Detergent solubilization:

    • Optimal detergents: n-Dodecyl-β-D-maltoside (DDM, 1%) or Lauryl maltose neopentyl glycol (LMNG, 1%)

    • Gentle rotation for 1-2 hours at 4°C

    • Ultracentrifugation (100,000×g, 1 hour) to remove insoluble material

  • Affinity chromatography:

    • Immobilized metal affinity chromatography using Ni-NTA for His-tagged DsbD

    • Binding in buffer containing low imidazole (10-20 mM)

    • Extensive washing to remove non-specifically bound proteins

    • Gradient elution with 50-300 mM imidazole

  • Size exclusion chromatography:

    • Superdex 200 or equivalent column

    • Buffer containing 150 mM NaCl, 20 mM Tris-HCl pH 7.5, and detergent at 2-3× CMC

    • Flow rate optimization to maximize resolution

This approach typically yields protein of >90% purity with retention of native folding and activity . For functional studies, it's critical to maintain reducing conditions throughout purification to preserve the redox-active cysteines in their reduced state.

How can I construct a dsbD knockout in K. pneumoniae?

To construct a dsbD knockout in K. pneumoniae, the λ Red recombinase system provides an efficient approach:

  • Preparation phase:

    • Transform K. pneumoniae with the pKD46-sp^r plasmid, which carries the λ Red recombinase genes under an arabinose-inducible promoter

    • Culture transformants at 30°C with spectinomycin selection to maintain the temperature-sensitive plasmid

  • Knockout cassette construction:

    • Design primers with 40-50 bp homology arms flanking the dsbD gene

    • Add sequences at 3' ends to amplify a kanamycin resistance cassette from pKD4

    • PCR amplify the knockout cassette and purify the product

    • Treat with DpnI to eliminate template plasmid

  • Transformation and recombination:

    • Prepare electrocompetent cells from K. pneumoniae containing pKD46-sp^r grown with arabinose induction

    • Electroporate the purified PCR product

    • Recover cells at 30°C for 3 hours in low-salt LB medium

    • Plate on kanamycin-containing medium and incubate at 37°C (to cure the temperature-sensitive pKD46-sp^r)

  • Verification:

    • Perform colony PCR using primers that anneal outside the recombination region

    • Sequence across the junction points to confirm precise integration

    • Verify the absence of the dsbD gene and presence of the kanamycin cassette

This method typically yields several correct transformants per electroporation, with a success rate of 5-10%. For creating unmarked deletions, the knockout strain can be subsequently transformed with a plasmid expressing FLP recombinase to excise the kanamycin cassette, leaving only an FRT scar sequence.

What strategies are effective for complementing dsbD mutants?

Effective complementation of dsbD mutants requires careful consideration of expression levels and proper membrane targeting. The following strategies have proven successful:

  • Vector selection:

    • Low to medium-copy plasmids (5-20 copies per cell) such as pACYC184 derivatives or pBBR1MCS series

    • Inclusion of native promoter elements (300-500 bp upstream region) for physiological expression

    • Addition of a C-terminal His-tag for verification without disrupting N-terminal signal sequence

  • Expression construct design:

    • Include the complete dsbD coding sequence with its native signal peptide

    • Maintain the native Shine-Dalgarno sequence for proper translation initiation

    • Consider including downstream sequence elements that may affect mRNA stability

  • Transformation approach:

    • Prepare electrocompetent cells from the dsbD knockout strain

    • Transform using optimized electroporation parameters for K. pneumoniae (2.5 kV, 200 Ω, 25 μF)

    • Recover in low-salt LB for extended periods (3-4 hours) before plating

  • Verification of complementation:

    • Confirm restoration of wild-type phenotypes (oxidative stress resistance, copper tolerance)

    • Verify DsbD expression by Western blot using anti-His antibodies or DsbD-specific antisera

    • Assess membrane localization by fractionation and immunoblotting

For rigorous studies, complementation with an unmarked chromosomal integration of dsbD should be considered to maintain native copy number and eliminate plasmid maintenance issues . This can be achieved using Tn7-based integration systems or recombination at neutral chromosomal sites.

What assays can quantitatively measure DsbD activity in vitro?

Several robust assays can quantitatively measure DsbD activity in vitro, each with specific advantages:

  • Insulin reduction assay:

    • Principle: DsbD provides electrons that ultimately reduce insulin, causing chain separation and aggregation

    • Protocol:

      • Reaction mixture: 0.1-0.5 μM purified DsbD, 0.13 mM insulin, thioredoxin (TrxA, 5 μM), thioredoxin reductase (TrxB, 0.5 μM), and NADPH (200 μM)

      • Monitor absorbance increase at 650 nm as reduced insulin chains aggregate

      • Quantify lag time and maximum rate of turbidity increase

    • Expected results: Active DsbD shows 3-5 fold acceleration of insulin reduction compared to controls

  • Periplasmic substrate reduction:

    • Principle: DsbD transfers electrons to oxidized periplasmic substrates such as DsbC

    • Protocol:

      • Prepare oxidized DsbC (containing intermolecular disulfides)

      • Incubate with DsbD and the complete thioredoxin system

      • Analyze by non-reducing SDS-PAGE to monitor formation of reduced DsbC

      • Quantify using densitometry of reduced vs. oxidized bands

    • Expected results: 50-80% reduction of DsbC within 30 minutes with active DsbD

  • Fluorescent substrate assay:

    • Principle: Reduction of a disulfide in a fluorophore-quencher pair increases fluorescence

    • Protocol:

      • Synthesize peptide substrate containing a CXXC motif with flanking recognition sequence

      • Label with fluorophore and quencher groups separated by the disulfide

      • Measure fluorescence increase at appropriate wavelengths

    • Expected results: Linear increase in fluorescence proportional to DsbD activity

These assays should include appropriate controls such as heat-inactivated DsbD, systems lacking individual components, and catalytically inactive DsbD mutants where the active site cysteines are replaced with serines . For highest confidence, results should be validated using multiple assay types.

How can I analyze the impact of dsbD on K. pneumoniae virulence?

Analyzing the impact of dsbD on K. pneumoniae virulence requires a multi-faceted approach combining in vitro and in vivo methods:

  • In vitro virulence factor analysis:

    • Capsule production: Quantify by uronic acid assay and visualize using India ink negative staining

    • Siderophore secretion: Measure using Chrome azurol S (CAS) assay

    • Biofilm formation: Crystal violet staining in static and flow conditions

    • Type VI secretion function: Bacterial competition assays against E. coli

    • Expected differences: 30-70% reduction in these factors in dsbD mutants

  • Cell culture infection models:

    • Macrophage survival assay: Infect RAW264.7 or primary macrophages with wild-type and dsbD mutant strains

    • Epithelial cell adhesion: Quantify adherence to human lung or urinary tract epithelial cells

    • Neutrophil killing resistance: Compare survival rates upon exposure to activated neutrophils

    • Expected results: 1-2 log reduction in intracellular survival and 40-70% decrease in adhesion

  • Animal infection models:

    • Pulmonary infection: Intranasal inoculation in mice, measure bacterial burden in lungs

    • Urinary tract infection: Transurethral inoculation, quantify bacteria in urine and kidneys

    • Systemic infection: Intraperitoneal injection, monitor survival and bacterial dissemination

    • Expected outcomes: 2-3 log reduction in bacterial burdens and significantly improved survival rates

  • Complementation analysis:

    • Compare wild-type, dsbD mutant, and complemented strain in all assays

    • Include domain-specific complementation to map functional regions

    • Test point mutations in active site cysteines to confirm redox mechanism

How does DsbD contribute to antibiotic resistance in K. pneumoniae?

DsbD contributes to antibiotic resistance in K. pneumoniae through several mechanisms that can be experimentally demonstrated:

  • β-lactamase stability and activity:

    • DsbD ensures proper folding of periplasmic β-lactamases, particularly those containing disulfide bonds

    • Experimental approach: Compare β-lactamase activity in wild-type and dsbD mutant strains using nitrocefin hydrolysis assays

    • Quantitative impact: dsbD mutants typically show 30-50% reduction in β-lactamase activity and 2-4 fold decreased MICs for various β-lactams

  • Membrane permeability and efflux systems:

    • DsbD maintains proper folding of outer membrane proteins and components of efflux pumps

    • Experimental measurement:

      • Membrane permeability: Assess uptake of fluorescent dyes (NPN, PI) and hydrophobic antibiotics

      • Efflux activity: Measure accumulation/efflux of substrates like ethidium bromide

    • Expected differences: 1.5-3 fold increased permeability and 30-50% reduced efflux activity in mutants

  • Biofilm-associated resistance:

    • DsbD supports production of biofilm matrix components and stress resistance within biofilms

    • Methodology: Compare biofilm formation, antibiotic penetration, and minimum biofilm eradication concentrations

    • Typical findings: 10-100 fold decreased antibiotic tolerance in dsbD mutant biofilms

  • Stress response coordination:

    • DsbD links redox homeostasis with antibiotic stress responses

    • Analysis approach: RNA-seq or qRT-PCR to measure expression of stress response regulons

    • Observed patterns: Constitutive activation of envelope stress responses but impaired induction of specific antibiotic resistance mechanisms

This multifaceted contribution makes DsbD an attractive target for antibiotic adjuvant development, as its inhibition could simultaneously compromise multiple resistance mechanisms. Combined treatments targeting DsbD function together with conventional antibiotics show synergistic effects, particularly against strains with acquired resistance mechanisms.

How do hypervirulent K. pneumoniae strains differ in their DsbD characteristics?

Hypervirulent K. pneumoniae (hvKP) strains exhibit several distinct characteristics in their DsbD proteins compared to classical K. pneumoniae (cKP) strains:

These differences suggest that DsbD has evolved specifically to support the enhanced virulence capabilities of hvKP strains, making it a potential biomarker for hypervirulence and a promising target for anti-virulence strategies specifically targeting hvKP infections .

What approaches can identify novel DsbD-interacting proteins in K. pneumoniae?

Identifying the interactome of DsbD in K. pneumoniae requires sophisticated protein-protein interaction methodologies adapted for membrane proteins:

  • In vivo crosslinking mass spectrometry:

    • Methodology:

      • Treat intact bacteria with membrane-permeable crosslinkers (formaldehyde or DSP)

      • Isolate DsbD using affinity purification under denaturing conditions

      • Identify crosslinked partners by LC-MS/MS

      • Confirm specific interactions by targeted pulldowns

    • Advantages: Captures physiological interactions in native membrane environment

    • Challenges: Distinguishing specific from non-specific interactions

  • Bacterial two-hybrid screening:

    • Implementation:

      • Create DsbD domain fusions to T18 fragment of adenylate cyclase

      • Screen against genomic library fused to T25 fragment

      • Select positive interactions on indicator media

      • Verify by reciprocal constructs and biochemical methods

    • Advantages: Systematic screening of whole proteome

    • Considerations: Limited to soluble domains, may miss transmembrane interactions

  • Substrate trapping approaches:

    • Design:

      • Generate DsbD variants with mutations in the resolving cysteine of CXXC motifs

      • These variants form stable mixed disulfides with substrates

      • Purify under non-reducing conditions and identify trapped proteins by MS

    • Advantages: Captures transient enzymatic interactions

    • Limitations: Only identifies redox substrates, not other interactors

  • Comparative redox proteomics:

    • Protocol:

      • Compare wild-type and dsbD mutant strains using differential thiol labeling

      • Block free thiols, reduce oxidized thiols, label with isotope-coded reagents

      • Identify proteins with altered redox states by quantitative proteomics

    • Advantages: Genome-wide view of proteins affected by DsbD

    • Considerations: Includes both direct and indirect effects

These approaches have identified several classes of DsbD-interacting proteins, including direct redox partners (DsbC, CcmG), virulence factors (components of secretion systems), and envelope stress responders (periplasmic chaperones) . Integration of multiple interaction detection methods provides the most comprehensive and reliable interactome data.

How can I design inhibitors targeting K. pneumoniae DsbD?

Designing inhibitors targeting K. pneumoniae DsbD requires a systematic structure-based approach:

  • Target site selection and validation:

    • Primary target sites:

      • Active site CXXC motifs in nDsbD and cDsbD domains

      • Substrate binding groove in nDsbD

      • Thioredoxin interaction surface in cDsbD

    • Validation approaches:

      • Site-directed mutagenesis to confirm importance for function

      • Molecular dynamics simulations to identify binding pocket dynamics

      • Fragment screening to identify initial binding hotspots

  • Screening cascade development:

    StageMethodologySuccess CriteriaProgression Rate
    Primary screeningFluorescence-based activity assays>50% inhibition at 10 μM0.1-0.5% hit rate
    Secondary screeningSurface plasmon resonance bindingK<sub>d</sub> < 10 μM10-20% confirmation
    Lead optimizationStructure-activity relationshipsIC<sub>50</sub> < 1 μM, selectivity > 10×Generate 20-50 derivatives
    Cellular validationGrowth under stress conditionsMIC < 10 μM, antibiotic synergy2-5 candidates
    In vivo testingMouse infection models>2 log CFU reduction1-2 development candidates
  • Chemical strategies with highest success probability:

    • Peptidomimetics based on natural DsbD substrates

    • Fragment-based design targeting active site adjacent pockets

    • Allosteric inhibitors preventing domain movements

    • Reversible covalent modifiers targeting active site cysteines

  • Key optimization considerations:

    • Penetration through Gram-negative outer membrane

    • Selectivity against human homologs (Txndc8, TXNDC17)

    • Stability in periplasmic environment

    • Low potential for resistance development

The most promising approach integrates computational design with medium-throughput biochemical screening, focusing initially on compounds that can penetrate the K. pneumoniae outer membrane and selectively bind DsbD without affecting host redox systems . Success in this endeavor could lead to novel antibiotic adjuvants that resensitize resistant K. pneumoniae to conventional antibiotics.

What structural features distinguish K. pneumoniae DsbD from human homologs for selective targeting?

Several structural features distinguish K. pneumoniae DsbD from human redox proteins, creating opportunities for selective therapeutic targeting:

  • Active site architecture differences:

    • K. pneumoniae DsbD: CPHC and CPYC motifs in nDsbD and cDsbD domains

    • Human thioredoxins: Predominantly CGPC motifs

    • Distinguishing features:

      • Different residues between the cysteines affect redox potential

      • Unique hydrogen bonding networks around active sites

      • K. pneumoniae-specific hydrophobic pocket adjacent to active site (volume ~150-200 ų)

  • Substrate binding groove characteristics:

    • K. pneumoniae DsbD: Deep groove with multiple hydrophobic patches

    • Human homologs: Shallower binding surfaces with different electrostatic properties

    • Exploitable differences:

      • K. pneumoniae-specific residues create unique binding pockets

      • Different surface charge distribution affects ligand recognition

      • Bacterial-specific secondary binding sites for enhanced selectivity

  • Domain organization and interfaces:

    • K. pneumoniae DsbD: Three-domain architecture with specific interdomain interfaces

    • Human system: Separate proteins for different functions

    • Targeting opportunities:

      • Bacterial-specific domain-domain interaction surfaces

      • Allosteric sites that regulate conformational changes unique to bacterial DsbD

      • Inhibitors that disrupt electron transfer between domains

  • Transmembrane region:

    • K. pneumoniae DsbD: Eight transmembrane helices with essential cysteines

    • No direct human counterpart with identical architecture

    • Selective targeting potential:

      • Unique water-accessible channel for electron transfer

      • Bacterial-specific residues lining the transmembrane helices

      • Different lipid interaction profiles compared to human membrane proteins

These structural differences provide a foundation for developing selective inhibitors that target K. pneumoniae DsbD while minimizing cross-reactivity with human redox proteins. The most promising approach focuses on the unique features of the substrate binding groove and domain interfaces, which show the greatest divergence from human proteins . Advanced modeling techniques combining homology models with molecular dynamics simulations can help identify and exploit these bacterial-specific structural elements.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.