Recombinant Klebsiella pneumoniae subsp. pneumoniae Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Description

Introduction

Klebsiella pneumoniae is a Gram-negative bacterium known for its role as an opportunistic pathogen, causing a range of hospital-acquired infections, including pneumonia, bloodstream infections, and urinary tract infections . The emergence of antibiotic-resistant strains of K. pneumoniae, particularly those resistant to carbapenems and polymyxins, poses a significant threat to public health . Understanding the mechanisms of antibiotic resistance in K. pneumoniae is crucial for developing effective strategies to combat these infections.

One key mechanism of polymyxin resistance in K. pneumoniae involves modifications to the bacterial cell surface, specifically the lipopolysaccharide (LPS) . These modifications are often mediated by the arnBCADTEF operon, which includes the arnC gene . ArnC, or Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase, plays a critical role in the synthesis of lipid A modifications that confer resistance to polymyxins .

Function and Mechanism of ArnC

ArnC is an undecaprenyl transferase that catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate . This transfer is a crucial step in the modification of lipid A, a component of the LPS layer in K. pneumoniae . The addition of 4-amino-4-deoxy-L-arabinose (L-Ara4N) to lipid A increases the positive charge of the bacterial cell surface, reducing the binding affinity of polymyxins, which are cationic antibiotics . This modification leads to decreased susceptibility to polymyxins, contributing to antibiotic resistance .

Genetic Context and Regulation

The arnC gene is typically found within the arnBCADTEF operon, which is involved in the biosynthesis and modification of lipid A . The expression of this operon is regulated by several factors, including two-component regulatory systems such as PmrA/PmrB and CrrA/CrrB . Mutations in these regulatory genes can lead to increased expression of the arn operon, resulting in elevated levels of L-Ara4N modification and increased polymyxin resistance .

Clinical Significance

The arnC gene and its role in polymyxin resistance have significant clinical implications. The spread of polymyxin-resistant K. pneumoniae strains poses a serious challenge to healthcare systems worldwide . Understanding the genetic and biochemical mechanisms underlying this resistance is essential for developing new therapeutic strategies.

Research and Further Studies

Further research is needed to fully elucidate the regulatory mechanisms controlling the expression of the arn operon and the activity of the ArnC enzyme. Identifying novel inhibitors of ArnC could provide a new approach to combat polymyxin resistance in K. pneumoniae . Additionally, understanding the evolutionary dynamics of the arn operon and its spread among different K. pneumoniae strains is crucial for implementing effective infection control measures. Studies of ramR and mgrB genes and their effects on polymyxin resistance have shown promising results in complementation experiments and mRNA assessments .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
arnC; KPN78578_38090; KPN_03846; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Target Names
arnC
Target Protein Sequence
MLTYPPVKKVSVVIPVYNEQDSLPELLRRTDAACATLGRQYEILLIDDGSSDDSARMLTE AAEAEGSHVVAVLLNRNYGQHSAIMAGFSHVTGDLIITLDADLQNPPEEIPRLVAKADEG YDVVGTVRQNRQDSIFRKTASKMINRLIQRTTGKAMGDYGCMLRAYRRHIIDAMLNCHER STFIPILANTFARRAVEIPVMHAEREFGDSKYSFMRLINLMYDLVTCLTTTPLRLLSIFG SVIALLGFAFGLLLVVLRLAFGPQWAAEGVFMLFAVLFMFIGAQFVGMGLLGEYIGRIYN DVRARPRYFIQRVVRQPETASKEEDRS
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A, contributing to resistance against polymyxin and cationic antimicrobial peptides.

Database Links
Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ArnC and what is its role in bacterial antimicrobial resistance?

ArnC is an integral membrane protein that functions as a glycosyltransferase in the lipid A modification pathway of Gram-negative bacteria. Specifically, ArnC catalyzes the condensation of undecaprenyl phosphate and UDP-4-deoxy-4-formylamino-L-arabinose (L-Ara4FN) to generate undecaprenyl phosphate-α-L-Ara4FN . This reaction is a critical step in the pathway that ultimately results in the addition of 4-amino-4-deoxy-L-arabinose (L-Ara4N) to lipid A, which reduces the net negative charge of the bacterial outer membrane and confers resistance to cationic antimicrobial peptides like polymyxins. Studies have demonstrated that deletion of the arnC gene decreases the level of UndP-Ara4FN, confirming its essential role in this resistance mechanism . The increasing prevalence of antimicrobial-resistant K. pneumoniae strains in healthcare settings makes understanding ArnC function particularly relevant to addressing public health threats.

What is known about the genetic organization of the arn operon in K. pneumoniae?

The arn operon (also known as pmrHFIJKLM or arnBCADTEF) encodes proteins necessary for the synthesis and transfer of L-Ara4N to lipid A. In K. pneumoniae, as in other Enterobacteriaceae, this operon is regulated by two-component systems responding to environmental signals such as low Mg²⁺, acidic pH, or the presence of antimicrobial peptides. The arnC gene specifically encodes the undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase. Genetic studies have confirmed the role of arnC by demonstrating that its deletion leads to decreased levels of undecaprenyl phosphate-Ara4FN . The expression of the arn operon is typically increased in antibiotic-resistant strains, particularly those showing resistance to polymyxins, making it an important genetic marker for resistance profiling. Understanding the genetic context of arnC provides insights into potential regulatory mechanisms that could be targeted for therapeutic intervention.

What structural features characterize ArnC and how do they relate to function?

Recent cryo-electron microscopy (cryo-EM) studies of Salmonella typhimurium ArnC have provided valuable insights into the structural organization of this integral membrane protein. The structure, determined at 2.75 Å resolution, revealed three main structural elements in the protomer and defined the mechanism of its tetrameric arrangement . The protein includes a substrate binding site whose location was identified through UDP-bound form analysis. These structural studies also identified a previously unresolved A-loop as a catalytically important structural element .

Based on comparative analysis with homologous proteins like GtrB and DPMS, researchers have identified key residues potentially involved in ArnC's catalytic activity, providing direction for future functional characterization . The tetrameric organization of ArnC likely facilitates its stability within the membrane and may be essential for proper enzyme function. The membrane-embedded nature of ArnC presents specific challenges for protein expression and purification, requiring specialized techniques for structural and functional studies.

What expression systems are most effective for producing recombinant K. pneumoniae ArnC?

Expression of recombinant integral membrane proteins like ArnC presents significant challenges due to their hydrophobic nature and complex folding requirements. For K. pneumoniae ArnC, bacterial expression systems, particularly engineered E. coli strains, have been successfully employed. When expressing ArnC, several factors must be optimized:

  • Expression vector selection: Vectors with tunable promoters (like pET series) allow control of expression levels to prevent toxicity and inclusion body formation.

  • Host strain optimization: E. coli strains like C41(DE3), C43(DE3), or Lemo21(DE3) are specifically designed for membrane protein expression and can enhance proper folding.

  • Solubilization strategies: Detergent screening is critical for extracting ArnC from membranes while maintaining its native fold and activity. Mild detergents like n-dodecyl-β-D-maltopyranoside (DDM) or lauryl maltose neopentyl glycol (LMNG) are often effective.

  • Fusion tags: Addition of solubility-enhancing tags (MBP, SUMO) can improve expression yields, while affinity tags (His6, FLAG) facilitate purification.

  • Expression conditions: Lower temperatures (16-25°C) and reduced inducer concentrations often enhance proper folding of membrane proteins.

For functional studies, establishing an in vitro activity assay using purified components (undecaprenyl phosphate and UDP-4-deoxy-4-formamido-L-arabinose) is essential to confirm that the recombinant protein retains catalytic activity.

How can the enzymatic activity of recombinant ArnC be reliably measured?

Measuring the enzymatic activity of recombinant ArnC requires assessing its ability to catalyze the condensation of undecaprenyl phosphate and UDP-4-deoxy-4-formamido-L-arabinose. Several complementary approaches can be employed:

  • Radiochemical assays: Using radiolabeled UDP-4-deoxy-4-formamido-L-arabinose (typically ¹⁴C or ³H labeled) to track product formation. After the reaction, products can be separated by thin-layer chromatography or organic extraction and quantified by scintillation counting.

  • HPLC/LC-MS analysis: Monitoring substrate consumption and product formation using chromatographic separation coupled with mass spectrometry detection. This approach allows for precise quantification of reaction components.

  • Coupled enzyme assays: Designing assays that link ArnC activity to the production of a detectable signal, such as the release of UDP, which can be coupled to additional enzymatic reactions producing a spectrophotometric readout.

  • Fluorescence-based assays: Developing fluorescently labeled substrate analogs that produce a measurable change in fluorescence properties upon conversion to product.

When establishing these assays, it's crucial to control for enzyme concentration, substrate saturation, and reaction linearity. Additionally, proper controls including heat-inactivated enzyme and reactions lacking key components must be included to validate assay specificity. Measuring enzyme kinetics under varying conditions (pH, temperature, divalent cation concentrations) can provide insights into the optimal conditions for ArnC activity and inform mechanistic studies.

How does the membrane environment influence ArnC structure and function?

The integral membrane nature of ArnC makes its activity inherently dependent on the surrounding lipid environment. Advanced research into this relationship should consider:

  • Lipid composition effects: Systematically varying the lipid composition in reconstituted proteoliposomes to determine how specific lipids (phosphatidylethanolamine, phosphatidylglycerol, cardiolipin) affect ArnC activity. This can be accomplished using purified lipids in defined ratios.

  • Membrane thickness and fluidity: Exploring how changes in acyl chain length and saturation alter ArnC function, potentially affecting its ability to access the undecaprenyl phosphate substrate within the membrane.

  • Lateral pressure profiles: Investigating how the distribution of lateral pressures within the membrane affects ArnC conformational states and catalytic efficiency.

  • Protein-lipid interactions: Using hydrogen-deuterium exchange mass spectrometry or site-directed spin labeling to identify specific lipid-interacting regions of ArnC and their functional significance.

  • Native nanodiscs: Employing lipid nanodiscs containing native K. pneumoniae membrane extracts to maintain the physiological lipid environment during in vitro studies.

The recent cryo-EM structure of Salmonella typhimurium ArnC provides a foundation for understanding how specific structural elements interact with the membrane environment . Particularly important is understanding how the tetrameric arrangement observed in the structure is stabilized by membrane interactions and how this relates to substrate access and product release pathways.

What are promising approaches for developing ArnC inhibitors as potential antimicrobial adjuvants?

Targeting ArnC represents a potential strategy for restoring sensitivity to polymyxins and other cationic antimicrobial peptides in resistant K. pneumoniae strains. Several approaches warrant exploration:

  • Structure-based drug design: Utilizing the recent cryo-EM structure to identify potential binding pockets, particularly those involving the catalytic site or substrate binding regions. Virtual screening of compound libraries against these sites can identify lead compounds for further optimization.

  • Transition state analogs: Designing compounds that mimic the transition state of the ArnC-catalyzed reaction, potentially achieving high-affinity binding and specific inhibition.

  • Allosteric inhibitors: Identifying regions away from the active site that could be targeted to induce conformational changes reducing catalytic efficiency.

  • Peptide-based inhibitors: Developing peptides that interfere with ArnC oligomerization or membrane association, disrupting its functional architecture.

  • Substrate/product analogs: Creating competitive inhibitors based on structural modifications of the natural substrates (undecaprenyl phosphate or UDP-4-deoxy-4-formamido-L-arabinose).

When evaluating potential inhibitors, it's essential to assess both their direct effect on ArnC activity and their ability to sensitize resistant K. pneumoniae strains to polymyxins in whole-cell assays. Additionally, selectivity screening against human glycosyltransferases is crucial to minimize off-target effects. The development of cell-penetrant inhibitors presents a particular challenge given the permeability barriers of Gram-negative bacteria and the membrane-embedded nature of the target enzyme.

How do post-translational modifications and protein-protein interactions regulate ArnC activity in vivo?

Understanding the regulatory network controlling ArnC activity in K. pneumoniae requires investigating:

  • Phosphorylation states: Using phosphoproteomics to identify potential phosphorylation sites on ArnC and determine how they affect enzyme activity, potentially linking ArnC function to broader cellular signaling networks.

  • Interaction partners: Employing proximity labeling techniques (BioID, APEX) to identify proteins that associate with ArnC in the native membrane environment, potentially including regulatory partners or other components of the lipid A modification machinery.

  • Complex formation: Investigating whether ArnC forms functional complexes with other Arn pathway proteins (particularly ArnD, which acts on the ArnC product) using techniques like blue native PAGE, chemical crosslinking coupled with mass spectrometry, or fluorescence resonance energy transfer (FRET).

  • Localization dynamics: Exploring whether ArnC undergoes redistribution within the bacterial membrane under stress conditions using fluorescent protein fusions and super-resolution microscopy.

  • Turnover regulation: Determining how ArnC stability and degradation are regulated in response to changing environmental conditions, potentially through proteomic pulse-chase experiments.

The integration of these approaches can provide a systems-level understanding of how ArnC activity is coordinated with other cellular processes to enable adaptive responses to antimicrobial challenges. This knowledge could reveal additional intervention points for disrupting antimicrobial resistance mechanisms in K. pneumoniae.

What are the optimal conditions for purifying active recombinant ArnC?

Purification of active recombinant ArnC requires careful optimization at each step to maintain the protein's native conformation and enzymatic activity:

  • Membrane preparation: After expression in the chosen host (typically E. coli), cells should be disrupted by mechanical methods (French press or sonication) in buffer containing protease inhibitors. Membranes are isolated by differential centrifugation, with careful washing to remove peripheral proteins.

  • Solubilization screening: A systematic detergent screen is essential, testing various detergent types (maltoside, glucoside, neopentyl glycol-based) at different concentrations. For each condition, both protein extraction efficiency and retention of enzymatic activity should be assessed.

  • Affinity chromatography: Utilizing an appropriate affinity tag (typically His6, FLAG, or Strep-tag II) for initial capture. Buffer composition during this step is critical, typically including detergent at concentrations above the critical micelle concentration (CMC), glycerol (10-20%) to enhance stability, and salt (150-300 mM) to reduce non-specific interactions.

  • Secondary purification: Size exclusion chromatography or ion exchange chromatography can remove aggregates and contaminants, providing more homogeneous preparations. During this stage, detergent can be exchanged if desired.

  • Quality assessment: Analytical techniques including SDS-PAGE, size exclusion chromatography with multi-angle light scattering (SEC-MALS), and negative-stain electron microscopy should be employed to verify protein purity, homogeneity, and oligomeric state.

  • Activity verification: Functional assays measuring catalytic activity should be performed at each purification stage to track retention of activity and identify steps causing activity loss.

For structural studies or long-term storage, reconstitution into proteoliposomes or nanodiscs may provide a more native-like environment that better preserves ArnC function compared to detergent micelles.

How can CRISPR-Cas9 genome editing be applied to study ArnC function in K. pneumoniae?

CRISPR-Cas9 technology offers powerful approaches for investigating ArnC function through precise genetic manipulation of K. pneumoniae:

  • Gene knockout studies: Complete deletion of arnC to assess its contribution to antimicrobial resistance phenotypes under various stress conditions. This requires:

    • Design of specific guide RNAs targeting the arnC coding sequence

    • Construction of a deletion template with homology arms flanking arnC

    • Optimization of transformation protocols for K. pneumoniae clinical isolates

    • Phenotypic characterization focusing on polymyxin susceptibility

  • Point mutations: Introduction of specific amino acid substitutions to test the importance of predicted catalytic residues or structural features identified in the cryo-EM structure . This includes:

    • Targeting conserved residues identified through structural and sequence analysis

    • Creating a range of mutations from conservative to non-conservative substitutions

    • Assessing the impact on both enzymatic activity and antibiotic resistance

  • Tagged variants: Insertion of epitope or fluorescent protein tags for localization and interaction studies, requiring careful placement to minimize functional disruption.

  • Inducible expression systems: Coupling CRISPR editing with the integration of inducible promoters to control arnC expression levels, allowing titration of ArnC activity and determination of threshold levels required for resistance.

  • Multiplexed editing: Simultaneous modification of arnC along with other arn operon genes to assess epistatic relationships and pathway synergies.

Each of these approaches requires careful optimization of transformation efficiency, selection strategies, and confirmation of genetic modifications through sequencing. Control experiments should include complementation with wild-type arnC to confirm that phenotypic changes are specifically due to the intended modifications.

How can structural information about ArnC be leveraged for antimicrobial development?

The recent determination of the ArnC structure from Salmonella typhimurium at 2.75 Å resolution provides a foundation for structure-based approaches to combat antimicrobial resistance . This structural information can be leveraged in several ways:

  • Comparative modeling: Generating homology models of K. pneumoniae ArnC based on the S. typhimurium structure to identify species-specific features that could be exploited for selective targeting.

  • Active site mapping: Detailed analysis of the substrate binding pocket and catalytic residues to design high-affinity inhibitors that block enzymatic activity.

  • Molecular dynamics simulations: Exploring the conformational flexibility of ArnC to identify transient pockets that may not be apparent in static structures but could serve as binding sites for allosteric inhibitors.

  • Fragment-based drug discovery: Using the structure to guide fragment screening, identifying small chemical moieties that bind to specific regions of ArnC and can be elaborated into more potent inhibitors.

  • Structure-based vaccine design: Identifying surface-exposed epitopes unique to ArnC that could serve as targets for antibody-mediated immunity, potentially disrupting ArnC function or marking cells for immune clearance.

The tetrameric arrangement of ArnC revealed by structural studies suggests that compounds disrupting oligomerization could represent an alternative strategy to direct active site inhibition. Additionally, understanding how ArnC interacts with membrane lipids could inform the development of compounds that disrupt these essential interactions.

What is the evolutionary relationship between ArnC and related glycosyltransferases across bacterial species?

Comparative genomic and phylogenetic analyses of ArnC across bacterial species can provide insights into:

  • Functional conservation: Determining whether ArnC orthologs from diverse species catalyze identical reactions or have evolved substrate specificities for different sugar donors or acceptors.

  • Structural diversity: Analyzing sequence conservation patterns in the context of the available structural data to identify highly conserved regions likely essential for function versus variable regions that may confer species-specific properties.

  • Horizontal gene transfer: Investigating whether the arn operon shows evidence of horizontal acquisition in K. pneumoniae lineages associated with enhanced virulence or antimicrobial resistance.

  • Selective pressures: Conducting evolutionary rate analysis to identify regions of ArnC under positive selection, potentially indicating adaptation to different antimicrobial challenges.

  • Functional divergence: Comparing ArnC to related glycosyltransferases like those studied in F. novicida (FlmF1 and FlmF2) to understand how functional specialization has occurred within this enzyme family.

This evolutionary perspective can inform predictions about which features of ArnC are essential for function across species (representing conserved targets for broad-spectrum inhibitors) versus those that might allow species-selective targeting. Furthermore, understanding the evolutionary trajectory of ArnC can provide insights into how antimicrobial resistance mechanisms have emerged and spread among pathogenic bacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.