Recombinant Klebsiella pneumoniae subsp. pneumoniae Universal stress protein B (uspB)

Shipped with Ice Packs
In Stock

Description

Stress Adaptation and Antimicrobial Resistance

uspB is integral to bacterial survival under stressors such as nutrient deprivation, oxidative stress, and antibiotic exposure:

  • Antimicrobial Resistance: Overexpression of uspB enhances tolerance to antibiotics like β-lactams and fluoroquinolones by modulating efflux pumps and DNA repair mechanisms .

  • Iron Scavenging: Facilitates iron uptake under iron-limited conditions, critical for colonization and immune evasion .

  • Oxidative Stress Mitigation: Regulates redox homeostasis, protecting K. pneumoniae from host-derived reactive oxygen species .

Pathogenicity Mechanisms

  • Immune Evasion: uspB suppresses NF-κB activation in host cells, dampening inflammatory responses and enabling persistent infections .

  • Biofilm Formation: Contributes to bacterial adhesion and biofilm maturation, enhancing resistance to phagocytosis .

Vaccine Development

While uspB itself has not been directly tested as a vaccine antigen, studies on K. pneumoniae outer membrane proteins (e.g., Kpn_Omp001/002/005) highlight the potential of stress-response proteins as targets:

  • Immune Response: Recombinant proteins induce Th1/Th17-polarized T-cell responses and opsonophagocytic antibodies in murine models .

  • Bacterial Clearance: Immunization reduces bacterial load in lungs, kidneys, and spleen by 1–2 log units .

Antimicrobial Resistance Studies

  • Gene Knockout Models: uspB-deficient K. pneumoniae mutants exhibit reduced survival under nutrient starvation and oxidative stress .

  • Efflux Pump Regulation: Linked to multidrug resistance (MDR) phenotypes in carbapenem-resistant K. pneumoniae strains .

Future Directions and Challenges

  • Therapeutic Targeting: Inhibiting uspB could disrupt bacterial stress adaptation, synergizing with existing antibiotics .

  • Vaccine Adjuvants: Evaluate uspB’s role in enhancing immunogenicity of polysaccharide-conjugate vaccines .

  • Mechanistic Studies: Resolve atomic-level structures to guide small-molecule inhibitor design .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing your order. We will prepare the product according to your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance stability for long-term storage at -20°C/-80°C, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution. Our standard final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
uspB; KPN78578_38220; KPN_03859; Universal stress protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Target Names
uspB
Target Protein Sequence
MISTIALFWALCVVCVVNMARYFSSLRALLVVLRGCDPLLYQYVDGGGFFTSHGQPSKQM RLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH
Uniprot No.

Target Background

Database Links
Protein Families
Universal stress protein B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of Universal Stress Protein B in Klebsiella pneumoniae?

Universal Stress Protein B (uspB) in Klebsiella pneumoniae belongs to a family of proteins that play critical roles in bacterial stress responses. Based on homology studies with other bacterial universal stress proteins, uspB likely participates in protecting K. pneumoniae cells during exposure to various environmental stressors. The protein is typically upregulated during both stationary phase and exponential growth phase when the bacterium encounters adverse conditions, similar to what has been observed in other bacterial species . Universal stress proteins generally function as part of a coordinated stress response system that enables bacterial survival under challenging conditions such as oxidative stress, acid stress, nutrient limitation, and exposure to antimicrobial agents. In K. pneumoniae specifically, uspB likely contributes to the bacterium's remarkable environmental persistence and its ability to survive in clinical settings, potentially influencing its pathogenicity and antimicrobial resistance profiles .

Within the cellular stress response network, uspB likely functions downstream of global stress regulators such as RpoS, which has been shown to regulate genes responsible for acidic response, hyperosmotic pressure, heat shock, oxidative stress, and various metabolic processes in K. pneumoniae . Understanding the precise role of uspB requires examining its expression patterns under different stress conditions and creating knockout mutants to observe resulting phenotypes.

How does the structure of uspB compare with other Universal Stress Proteins?

While the specific three-dimensional structure of Klebsiella pneumoniae uspB has not been fully characterized in the provided literature, we can make informed predictions based on homology to other Universal Stress Proteins that have been studied structurally. USPs typically exhibit a conserved structural architecture characterized by a Rossmann-like α/β-fold consisting of five parallel β-strands and four α-helices . This structural motif is commonly found in nucleotide-binding proteins and suggests that uspB may interact with ATP or other nucleotides.

By analogy with other characterized USPs, K. pneumoniae uspB likely forms oligomeric structures, potentially a homo-tetrameric quaternary structure similar to that observed in the USP from Listeria innocua . In such structures, each monomer contributes to the formation of a functional unit through specific inter-chain contacts involving conserved hydrophobic residues. The region containing structurally conserved residues in β-strand 5 (particularly residues analogous to V146 and V148 in Listeria USP) would be expected to participate in inter-chain contacts . Similarly, conserved residues in the α4 region likely function as hot spots in monomer-monomer interface assembly.

Importantly, many USPs contain a conserved ATP-binding motif with the consensus sequence G-2X-G-9X-G(S/T-N), which may play a role in stabilizing oligomeric assemblies . Phylogenetic analysis would likely position K. pneumoniae uspB in a distinct clade from USPs of organisms like Pseudomonas, E. coli, and Salmonella, reflecting evolutionary adaptations specific to the Klebsiella genus.

What expression systems are most effective for producing recombinant K. pneumoniae uspB?

For successful expression of recombinant Klebsiella pneumoniae uspB, E. coli-based expression systems generally offer the most practical and efficient approach for academic research settings. When selecting an expression system, researchers should consider several factors to optimize protein yield and functionality. Typically, BL21(DE3) or its derivatives are preferred host strains due to their reduced protease activity and compatibility with T7 promoter-based expression vectors. Vector selection should be based on the intended experimental applications; pET series vectors provide high-level expression under IPTG induction, while pBAD vectors offer more tightly controlled, arabinose-inducible expression that may be beneficial if uspB shows toxicity when overexpressed.

Expression conditions require careful optimization, as universal stress proteins can form inclusion bodies when overexpressed. A recommended approach is to start with lower induction temperatures (16-25°C) rather than the standard 37°C, and to use lower inducer concentrations (0.1-0.5 mM IPTG for T7 systems). Including solubility-enhancing fusion tags such as MBP (maltose-binding protein) or SUMO can significantly improve soluble protein yields. For purification, a combination of immobilized metal affinity chromatography (using His-tags) followed by size exclusion chromatography is typically effective for obtaining pure, correctly folded uspB protein.

When expressing stress response proteins like uspB, researchers should be aware that expression conditions themselves may trigger stress responses in the host cells, potentially affecting protein quality. It's advisable to monitor cell growth carefully during expression and to validate the functionality of the purified protein through activity assays specific to universal stress proteins.

What genetic manipulation techniques are most suitable for studying uspB function in K. pneumoniae?

Genetic manipulation of Klebsiella pneumoniae to study uspB function requires specialized techniques due to the bacterium's robust capsule and potential resistance mechanisms. The λ Red recombinase system represents one of the most efficient approaches for generating isogenic mutants in K. pneumoniae, allowing for precise gene deletions or modifications . This system requires preparing electrocompetent K. pneumoniae cells specifically optimized for recombineering, followed by electroporation of linear DNA fragments containing antibiotic resistance cassettes flanked by homology regions matching the uspB gene locus .

The protocol for preparing recombineering-competent K. pneumoniae cells differs from standard electrocompetent cell preparation, as it requires the prior introduction of a plasmid expressing the λ Red recombinase enzymes. After successful transformation and selection, researchers should confirm knockout mutants via colony PCR using primers that flank the deleted region . Additionally, verification of the absence of secondary mutations is critical, as unintended mutations elsewhere in the genome could confound phenotypic analyses .

For more sophisticated genetic analyses, generating unmarked knockout mutants using the pFLP plasmid system is recommended . This approach allows for the removal of the antibiotic resistance cassette after confirmation of gene deletion, leaving only a small scar sequence. This is particularly valuable when creating multiple mutations in the same strain or when studying the effects of uspB deletion without the potentially confounding effects of an antibiotic resistance gene.

For complementation studies to confirm phenotypes associated with uspB deletion, constructing a complementation vector containing the wild-type uspB gene under its native promoter is essential . This can be accomplished by PCR amplification of the uspB gene with its promoter region from wild-type K. pneumoniae, followed by cloning into a suitable vector for reintroduction into the deletion mutant.

How can transcriptomic analysis be effectively applied to understand uspB regulation in hypervirulent K. pneumoniae strains?

Transcriptomic analysis provides powerful insights into the regulatory networks controlling uspB expression in hypervirulent Klebsiella pneumoniae strains. When designing transcriptomic experiments to study uspB regulation, researchers should consider an integrated approach that captures both the conditions triggering uspB expression and the downstream effects of uspB activity. Begin by exposing both wild-type and uspB-deficient strains to various stress conditions relevant to clinical settings, including exposure to sub-inhibitory concentrations of antibiotics, pH stress, oxidative stress, and nutrient limitation . These conditions should be carefully standardized to ensure reproducibility.

RNA extraction should be performed using methods that preserve RNA integrity despite the robust cell wall of K. pneumoniae. For RNA-Seq analysis, consider using strand-specific library preparation to capture antisense transcription that might regulate uspB expression. When analyzing differential gene expression, pay particular attention to the relationship between uspB and global stress regulators such as RpoS, which has been shown to coordinate stress responses in K. pneumoniae .

The analysis should focus on identifying co-regulated gene clusters that may form functional modules with uspB. This can reveal whether uspB is part of specific stress response pathways or contributes to broader physiological adaptations. Additionally, comparing transcriptomic profiles between classical and hypervirulent K. pneumoniae strains can illuminate how uspB regulation might differ in these contexts and potentially contribute to enhanced virulence or antibiotic resistance .

A robust transcriptomic analysis should also include validation of key findings using RT-qPCR and functional studies of genes identified as co-regulated with uspB. This integrated approach can map the position of uspB within the complex regulatory networks that enable K. pneumoniae to adapt to diverse environments and stressors, ultimately contributing to its success as a pathogen.

What approaches can be used to determine if uspB influences antimicrobial resistance in K. pneumoniae?

Determining whether Universal Stress Protein B influences antimicrobial resistance in Klebsiella pneumoniae requires a multifaceted experimental approach that addresses both direct and indirect contributions to resistance phenotypes. The investigation should begin with the generation of uspB knockout mutants using the λ Red recombinase system, followed by comprehensive antimicrobial susceptibility testing . This should include determination of minimum inhibitory concentrations (MICs) for a wide range of antibiotics representing different mechanistic classes (β-lactams, aminoglycosides, fluoroquinolones, polymyxins, etc.) against both wild-type and ΔuspB strains.

Since universal stress proteins often contribute to stress tolerance rather than directly conferring resistance, researchers should examine how uspB affects bacterial survival under combined stressors that mimic in vivo conditions. For instance, testing antibiotic efficacy under varying pH, osmotic stress, or oxidative stress conditions may reveal condition-specific roles of uspB in resistance . Time-kill assays rather than simple MIC determinations can provide more nuanced insights into how uspB affects the kinetics of bacterial killing by antibiotics.

For a comprehensive understanding, in vivo infection models should be used to assess whether uspB contributes to treatment failure in a more complex environment. This could involve comparing the efficacy of antibiotic treatment against wild-type and ΔuspB strains in appropriate animal models, with particular attention to bacterial persistence following antibiotic treatment.

What bioinformatics approaches are most effective for predicting uspB structure and function?

Effective bioinformatics analysis of Klebsiella pneumoniae uspB structure and function requires an integrated computational pipeline that leverages evolutionary information, structural prediction, and functional annotation. Begin with comprehensive sequence analysis by performing multiple sequence alignments of uspB with characterized universal stress proteins from diverse bacterial species. This helps identify conserved motifs, particularly the ATP-binding motif G-2X-G-9X-G(S/T-N) that is characteristic of many USPs . Use HMMER or similar tools to search for conserved domains and classify uspB within the USP family hierarchy.

For structural prediction, employ a combination of homology modeling and ab initio approaches. AlphaFold2 or RoseTTAFold provide state-of-the-art prediction capabilities that can generate reliable structural models even with relatively distant homologs as templates. If uspB is predicted to form oligomeric structures, molecular docking and interface analysis tools can predict quaternary arrangements and identify key residues involved in monomer-monomer interactions, similar to those identified in the USP from Listeria (residues analogous to V146, V148, I139, and H141) . Verify model quality using tools like MolProbity and PROCHECK before proceeding to further analyses.

Functional annotation should incorporate prediction of ligand-binding sites (particularly for ATP), protein-protein interaction interfaces, and post-translational modification sites. Molecular dynamics simulations can provide insights into protein flexibility and potential conformational changes under different conditions, such as ATP binding or pH changes. These simulations should incorporate physiologically relevant conditions that mimic the stresses K. pneumoniae encounters during infection.

Integrating these predictions with transcriptomic data can reveal co-expression patterns and potential functional associations. Gene neighborhood analysis may also identify genomic context patterns that suggest functional relationships with other genes. Throughout this pipeline, critical evaluation of prediction confidence is essential, with experimental validation plans for key structural and functional predictions.

How can protein-protein interaction studies reveal uspB's role in stress response pathways?

Investigating protein-protein interactions (PPIs) of Universal Stress Protein B provides critical insights into its integration within K. pneumoniae stress response networks. A comprehensive approach begins with bacterial two-hybrid (B2H) or split-protein complementation assays to screen for potential interacting partners in vivo. These systems are preferable to yeast two-hybrid approaches for bacterial proteins as they better represent the native cellular environment. For B2H screening, the uspB gene should be cloned into both bait and prey vectors to capture interactions where uspB acts as either donor or receptor in the interaction.

Co-immunoprecipitation followed by mass spectrometry (Co-IP-MS) offers a more unbiased approach to identifying the uspB interactome. This requires generating a tagged version of uspB that can be expressed in K. pneumoniae without disrupting its function. Cells should be subjected to relevant stress conditions before protein extraction to capture stress-specific interactions. Quantitative proteomics using stable isotope labeling can distinguish between constitutive and stress-induced interactions.

For validation and detailed characterization of identified interactions, surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) provides quantitative binding parameters. These biophysical techniques require purified recombinant proteins but deliver precise affinity constants and thermodynamic parameters. When analyzing uspB interactions with global regulators like RpoS, chromatin immunoprecipitation followed by sequencing (ChIP-seq) can reveal whether these factors directly regulate uspB expression under stress conditions .

Functional validation of identified interactions should include phenotypic analysis of double mutants (ΔuspB plus deletion of an interacting partner) to identify synthetic phenotypes that suggest functional relationships. Additionally, fluorescence microscopy using fluorescently tagged uspB can reveal dynamic changes in protein localization during stress responses and potential co-localization with interaction partners.

The interaction data should ultimately be integrated into a network model that positions uspB within the broader stress response architecture of K. pneumoniae, highlighting both direct interactions and functional modules that include uspB.

What methods are most suitable for analyzing uspB expression under different stress conditions?

Analyzing uspB expression under various stress conditions requires a methodological framework that captures both transcriptional and translational regulation with temporal resolution. For quantitative measurement of uspB transcription, RT-qPCR remains the gold standard when examining a limited number of conditions. This should employ carefully validated reference genes whose expression remains stable under the stress conditions being tested. For genome-wide context, RNA-Seq provides comprehensive transcriptional profiles that can reveal co-regulated genes and potential regulatory networks involving uspB .

Construction of transcriptional and translational reporter fusions offers powerful tools for monitoring uspB expression dynamics. A uspB promoter-GFP fusion allows real-time monitoring of transcriptional activity in living cells using fluorescence microscopy or flow cytometry. This approach is particularly valuable for tracking expression heterogeneity within bacterial populations under stress. For translational regulation, a translational fusion that incorporates the uspB 5' UTR and early coding sequence can reveal post-transcriptional control mechanisms.

At the protein level, western blotting using specific antibodies against uspB provides direct measurement of protein abundance. For higher throughput analysis, targeted proteomics using selected reaction monitoring (SRM) or parallel reaction monitoring (PRM) mass spectrometry enables precise quantification of uspB across multiple conditions. These approaches should be complemented by pulse-chase experiments to determine uspB protein stability under different stresses.

The experimental design should include a comprehensive stress panel reflecting conditions K. pneumoniae encounters during infection and environmental persistence: acid stress (pH 4.5-6.5), oxidative stress (H₂O₂, superoxide generators), osmotic stress (NaCl, sucrose), heat shock, nutrient limitation, and sub-inhibitory concentrations of relevant antibiotics . Time-course sampling is essential, as uspB expression may show complex dynamics with both early and late responses to stress. Integration of these expression data with phenotypic assays measuring stress tolerance in wild-type versus ΔuspB strains will establish functional correlations between expression patterns and physiological roles.

How might uspB contribute to the hypervirulence phenotype in emerging K. pneumoniae strains?

The potential contribution of Universal Stress Protein B to hypervirulence in emerging Klebsiella pneumoniae strains represents a complex interplay between stress adaptation and virulence mechanisms. Hypervirulent K. pneumoniae strains differ from classical strains in their ability to cause severe, invasive infections in otherwise healthy individuals, suggesting enhanced ability to overcome host defenses and survive in diverse host environments . The uspB protein may play several critical roles in this enhanced pathogenicity through both direct and indirect mechanisms.

Firstly, uspB likely contributes to bacterial survival during host-imposed stresses, including oxidative burst from phagocytes, antimicrobial peptides, pH fluctuations in different tissue compartments, and nutrient limitation. Enhanced stress tolerance through uspB could enable hypervirulent strains to persist longer during initial host colonization, allowing sufficient time for virulence factor expression. This stress tolerance function appears to be regulated by RpoS, a global stress response regulator that has been shown to enhance environmental stress and disinfectant resistance in K. pneumoniae, potentially at the cost of reduced virulence in some contexts .

Secondly, uspB may influence the expression or function of established virulence factors. Hypervirulent K. pneumoniae typically possess virulence plasmids carrying genes for enhanced capsule production, siderophores, and other virulence determinants . If uspB interacts with regulatory networks controlling these virulence factors, it could modulate their expression in response to environmental conditions, potentially enhancing virulence during specific stages of infection.

The emergence of hypervirulent strains that have acquired antimicrobial resistance genes has created "true and dreaded superbugs" . In this context, uspB may contribute to both antibiotic tolerance and virulence, forming a mechanistic bridge between these two concerning phenotypes. To definitively establish uspB's role in hypervirulence, comparative studies are needed between isogenic ΔuspB mutants in both classical and hypervirulent genetic backgrounds, using both in vitro virulence assays and in vivo infection models that recapitulate the tissue-invasive nature of hypervirulent K. pneumoniae infections.

How can structural analysis of uspB inform the development of novel antimicrobial strategies?

Structural analysis of Universal Stress Protein B in Klebsiella pneumoniae offers promising avenues for developing targeted antimicrobial strategies that could help address the growing crisis of multi-drug resistant hypervirulent strains. A structure-based drug design approach begins with obtaining high-resolution structural data through X-ray crystallography, cryo-electron microscopy, or reliable computational models based on homology to characterized USPs. The predicted Rossmann-like α/β-fold architecture with its ATP-binding pocket represents a potential druggable site, particularly if this site is essential for uspB function in stress response .

The oligomeric structure of uspB, likely analogous to the homo-tetrameric structure observed in other USPs, presents additional targeting opportunities . The interfaces between monomers often contain highly conserved residues that are critical for protein function. Small molecules designed to disrupt these protein-protein interactions could destabilize the functional oligomeric form of uspB, thereby compromising bacterial stress tolerance without directly targeting enzymatic activity.

Comparison of the uspB structure with human proteins is crucial to identify features unique to the bacterial protein that can be exploited for selectivity. Molecular dynamics simulations can reveal conformational changes that occur during stress responses or upon ATP binding, potentially exposing cryptic binding sites not apparent in static structures. These transient pockets sometimes offer superior opportunities for selective targeting compared to highly conserved active sites.

Once potential binding sites are identified, virtual screening of compound libraries against these sites can identify candidate inhibitors. These should be evaluated for their impact on purified uspB stability and function in vitro, followed by assessment of their ability to sensitize K. pneumoniae to stress conditions and antibiotics. The most promising candidates would then be optimized for improved pharmacokinetic properties and reduced toxicity.

Rather than developing uspB inhibitors as standalone antimicrobials, a more promising strategy may be to create adjuvants that sensitize K. pneumoniae to existing antibiotics by compromising stress response capabilities. This approach could help revitalize the effectiveness of current antibiotics against resistant strains while minimizing selection pressure for developing resistance to the new compounds.

What role might uspB play in K. pneumoniae environmental persistence and transmission?

Universal Stress Protein B likely plays a significant role in Klebsiella pneumoniae's remarkable ability to persist in diverse environmental niches, which directly impacts its transmission dynamics in both healthcare and community settings. K. pneumoniae can survive on abiotic surfaces, in water systems, and in soil for extended periods, serving as reservoirs for infection . The uspB protein likely contributes to this environmental resilience through multiple mechanisms that warrant systematic investigation.

One critical aspect is uspB's potential role in the formation and maintenance of biofilms, which protect bacteria from desiccation, disinfectants, and other environmental stressors. Comparing biofilm formation between wild-type and ΔuspB strains under various environmental conditions (different surfaces, temperatures, nutrient availability) can reveal uspB's contribution to this important survival strategy. Microscopic analysis of biofilm architecture using fluorescent reporters can further elucidate how uspB affects spatial organization and matrix composition.

The uspB protein may also contribute to K. pneumoniae's tolerance to disinfectants and sterilization procedures commonly used in healthcare settings. RpoS, which likely regulates uspB, has been shown to enhance tolerance to environmental stress and disinfectants in K. pneumoniae . Testing survival rates of wild-type versus ΔuspB strains following exposure to clinical disinfectants, UV radiation, and temperature fluctuations can quantify uspB's contribution to these tolerance phenotypes.

Environmental transmission often involves transitions between nutrient-rich and nutrient-limited conditions. The uspB protein may be particularly important during nutrient limitation, helping bacteria enter a metabolically quiescent state that enhances survival. Metabolomic analysis comparing wild-type and ΔuspB strains during nutrient limitation could reveal how uspB influences metabolic adaptations during environmental persistence.

From a public health perspective, understanding uspB's role in environmental persistence could inform improved disinfection strategies for healthcare settings and water systems, potentially reducing transmission of hypervirulent and multidrug-resistant strains that have emerged as serious global threats . Environmental sampling coupled with molecular typing and phenotypic analysis of uspB expression in environmental isolates could establish correlations between uspB activity and persistence in real-world settings.

What are the current technical limitations in studying uspB function and how might they be overcome?

Research on Universal Stress Protein B in Klebsiella pneumoniae faces several technical challenges that require innovative approaches to overcome. One significant limitation is the potential functional redundancy among multiple USP family members in K. pneumoniae. Single gene knockouts may show subtle phenotypes due to compensation by other USPs. To address this, researchers should consider creating multiple USP gene deletions using sequential application of the λ Red recombinase system with different selection markers . Alternatively, CRISPR interference (CRISPRi) systems adapted for K. pneumoniae could allow simultaneous knockdown of multiple USP genes without the need for multiple antibiotic markers.

Another challenge lies in studying uspB under physiologically relevant stress conditions that accurately mimic those encountered during infection. Standard laboratory stress models often fail to capture the complex, dynamic nature of host environments. Developing more sophisticated in vitro systems, such as microfluidic devices that can create spatial and temporal gradients of stressors, would enable more nuanced analysis of uspB function. Additionally, ex vivo systems using explanted tissues or organoids could bridge the gap between oversimplified in vitro models and complex in vivo systems.

The study of protein-protein interactions involving uspB presents technical hurdles due to the potentially transient nature of these interactions during stress responses. Traditional approaches may miss important but fleeting interactions. Proximity labeling techniques such as BioID or APEX2, adapted for use in K. pneumoniae, could capture these transient interactions by covalently tagging proteins that come into proximity with uspB during stress responses.

For structural studies, the potential conformational heterogeneity of uspB, particularly if it undergoes significant structural changes upon stress or ligand binding, may complicate crystallization efforts. Integrating hydrogen-deuterium exchange mass spectrometry (HDX-MS) with cryo-electron microscopy could help capture different conformational states and provide insights into dynamic structural changes during stress responses.

Finally, translating findings from laboratory strains to clinical isolates presents challenges due to genetic diversity among K. pneumoniae strains. Developing high-throughput phenotyping methods to assess uspB function across diverse clinical isolates, coupled with whole genome sequencing, could help establish correlations between uspB sequence variants and functional differences in stress response.

How might comparative analysis of uspB across different Klebsiella species inform our understanding of its evolution and specialization?

Comparative analysis of Universal Stress Protein B across different Klebsiella species and related Enterobacteriaceae provides a powerful framework for understanding its evolutionary trajectory and functional specialization. This evolutionary perspective can reveal how uspB has adapted to specific ecological niches and stress conditions encountered by different Klebsiella species, potentially explaining virulence differences between species like K. pneumoniae, K. variicola, and K. oxytoca.

Comparative genomic context analysis examining the genomic neighborhood of uspB across species can reveal conservation or rearrangement of gene clusters, potentially indicating functional associations. This synteny analysis may uncover regulatory elements or functionally related genes that have co-evolved with uspB. Additionally, analyzing uspB copy number and paralog distribution across species could reveal duplication events that might have facilitated functional diversification.

Experimental validation should include heterologous complementation studies where uspB genes from different Klebsiella species are expressed in a K. pneumoniae ΔuspB background to assess functional conservation and specialization. Stress tolerance assays under conditions relevant to different ecological niches (e.g., plant-associated versus mammalian host-associated) could reveal niche-specific adaptations in uspB function.

Structural comparisons based on homology models or experimentally determined structures can identify species-specific variations in key functional regions, such as ATP-binding sites or oligomerization interfaces . These structural differences may correlate with functional specialization for specific stress responses.

The integration of these comparative analyses with ecological and clinical data could establish connections between uspB evolution and the emergence of hypervirulent lineages or host adaptation, providing insights into the molecular basis of Klebsiella pathoadaptation and potentially identifying conserved vulnerabilities that could be targeted for broad-spectrum intervention strategies.

What novel approaches might reveal unexpected functions of uspB beyond conventional stress response roles?

Discovering non-canonical functions of Universal Stress Protein B in Klebsiella pneumoniae requires innovative experimental approaches that venture beyond traditional stress response paradigms. One promising direction involves unbiased screening for phenotypes not traditionally associated with stress responses. This could include high-throughput screening of ΔuspB mutants for altered metabolism using Biolog phenotype microarrays, which can test carbon, nitrogen, phosphorus, and sulfur source utilization simultaneously. Unexpected metabolic phenotypes could reveal roles for uspB in metabolic regulation beyond stress adaptation.

Advanced imaging techniques can uncover potential structural roles or specific subcellular localizations of uspB that suggest non-canonical functions. Super-resolution microscopy of fluorescently tagged uspB under various growth conditions might reveal unexpected localization patterns, such as association with the cell envelope, nucleoid, or specific protein complexes. This approach could be complemented by biochemical fractionation to determine uspB's distribution among different cellular compartments.

Interactomics approaches that capture the full spectrum of uspB's protein and nucleic acid interactions could reveal surprising binding partners. Techniques such as CRISPR-based CAPTURE (CRISPR Affinity Purification in Tandem) could identify potential DNA-binding sites if uspB has unexpected roles in gene regulation. Similarly, RNA immunoprecipitation followed by sequencing (RIP-seq) could uncover interactions with RNA if uspB functions in post-transcriptional regulation.

Metabolomic analysis comparing wild-type and ΔuspB strains under non-stress conditions might reveal unexpected roles in primary metabolism. Stable isotope labeling could track specific metabolic fluxes that are altered in the absence of uspB, potentially uncovering roles in central carbon metabolism or secondary metabolite production that extend beyond stress adaptation.

Host-pathogen interaction studies focusing on uspB's impact on immune recognition and modulation could reveal immunomodulatory functions. Comparing host cell responses to wild-type versus ΔuspB K. pneumoniae using transcriptomic analysis of infected host cells might uncover effects on inflammatory pathways or innate immune signaling.

Finally, exploring potential horizontal gene transfer and mobile genetic element associations with uspB might reveal roles in genome plasticity or as part of defense systems against foreign DNA. Analysis of uspB distribution in relation to genomic islands, prophages, or CRISPR-Cas systems could suggest functions in bacterial immunity or genome maintenance that represent truly novel aspects of universal stress protein biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.