Recombinant Klebsiella pneumoniae subsp. pneumoniae UPF0059 membrane protein KPN78578_23020 (KPN78578_23020)

Shipped with Ice Packs
In Stock

Description

Taxonomic Context

Klebsiella pneumoniae is a gram-negative, encapsulated bacterium belonging to the Enterobacteriaceae family. The specific strain relevant to our protein of interest is Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) . This strain has been fully sequenced and serves as an important reference strain for genomic and proteomic studies of this pathogen.

Membrane Protein Classification

The UPF0059 membrane protein KPN78578_23020 belongs to a family of uncharacterized proteins found in various bacterial species. The "UPF" designation (Uncharacterized Protein Family) indicates that the precise biological function of this protein class has not been fully elucidated, though structural characteristics suggest membrane integration . As an integral membrane protein, it likely plays roles in cellular processes such as transport, signaling, or maintaining membrane integrity.

Genetic Information

The protein is encoded by the gene KPN78578_23020 with alternative locus name KPN_02337 . These systematic identifiers relate to the genomic organization of Klebsiella pneumoniae strain ATCC 700721 / MGH 78578. The expression region spans amino acids 1-188, indicating the full length of the mature protein.

Table 1: Genetic Identifiers of KPN78578_23020

ParameterInformation
Primary Gene NameKPN78578_23020
Alternative Locus NameKPN_02337
ORF NamesKPN_02337
UniProt AccessionA6TAZ2
Expression Region1-188
Sequence TypeFull length protein

Product Characteristics

The recombinant form of UPF0059 membrane protein KPN78578_23020 is commercially available for research purposes with the following specifications :

Table 2: Recombinant Protein Specifications

PropertyDescription
Quantity50 μg (other quantities also available)
Product TypeRecombinant Protein
Source OrganismKlebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Protein TagVariable (determined during production process)
Molecular WeightApproximately 19-20 kDa (estimated from amino acid sequence)
PurityNot specifically stated in available sources

Related Membrane Proteins

Within the same bacterial strain, other membrane proteins have been identified and characterized. One example is the UPF0266 membrane protein KPN78578_23010 (KPN78578_23010), which shares some characteristics with our protein of interest . Both are membrane proteins from the same strain of Klebsiella pneumoniae but belong to different UPF families.

Table 4: Comparison Between Related Membrane Proteins

FeatureUPF0059 KPN78578_23020UPF0266 KPN78578_23010
UniProt IDA6TAZ2A6TAZ1
Length188 amino acids152 amino acids
Amino Acid SequenceMNLSATILLAFGMSMDAFAAA...MTFTDLVIILFILALLAYAI...
Gene DesignationKPN78578_23020/KPN_02337KPN78578_23010/KPN_02336

This comparison highlights the diversity of membrane proteins even within a single bacterial strain, suggesting specialized roles for each protein.

Analytical Techniques

Advanced techniques for membrane protein analysis could be applied to study UPF0059 membrane protein KPN78578_23020. Flow-induced dispersion analysis (FIDA) technology allows characterization of membrane proteins without purification, working directly with unpurified samples like cell lysates . This approach could be particularly valuable for studying this protein in near-native conditions.

Potential Research Areas

While specific research on this protein is limited in the current literature, several potential applications exist:

Table 5: Potential Research Applications

Research AreaPotential Investigations
Functional StudiesDetermination of transport activity, substrate specificity, or signaling roles
Structural BiologyDetailed structure determination through crystallography or cryo-electron microscopy
Immunological ResearchDevelopment of antibodies for detection and localization studies
Antimicrobial DevelopmentExploration as a potential drug target if essential for bacterial viability
Membrane BiologyInvestigation of role in membrane organization and bacterial physiology

Handling Recombinant Membrane Proteins

Working with membrane proteins presents unique challenges due to their hydrophobic nature and tendency to aggregate outside their native lipid environment. When designing experiments with UPF0059 membrane protein KPN78578_23020, researchers should consider:

  1. Buffer optimization to maintain protein stability

  2. Addition of detergents or lipids to mimic membrane environment

  3. Temperature sensitivity during handling and assays

  4. Minimizing freeze-thaw cycles as recommended by manufacturers

  5. Appropriate reconstitution techniques if supplied as lyophilized powder

Expression Systems

While not explicitly stated in the available search results, recombinant membrane proteins are typically produced in specialized expression systems. For bacterial membrane proteins like KPN78578_23020, common approaches include:

Table 6: Common Expression Systems for Bacterial Membrane Proteins

Expression SystemAdvantagesLimitations
Escherichia coliHigh yield, cost-effective, genetic similarity to KlebsiellaPotential toxicity, inclusion body formation
Cell-free systemsAvoids toxicity issues, direct incorporation into nanodiscsLower yields, higher cost
Yeast systemsPost-translational modifications, eukaryotic membraneDifferences in membrane composition

Selection of an appropriate expression system depends on the specific experimental goals and requirements for the recombinant protein.

Functional Characterization

A primary research priority should be determining the biological function of UPF0059 membrane protein KPN78578_23020. Approaches might include:

  1. Gene knockout studies to observe phenotypic effects

  2. Protein-protein interaction studies to identify binding partners

  3. Transport assays to test potential substrates

  4. Localization studies to determine precise membrane distribution

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please include your desired format in the order remarks and we will fulfill your request.
Lead Time
Delivery times may vary based on the purchasing method and location. For specific delivery estimates, please consult your local distributors.
Note: Our standard shipping procedure includes normal blue ice packs. If dry ice shipping is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage (up to one week), store working aliquots at 4°C.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference point for your own preparations.
Shelf Life
The shelf life of this product is dependent on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use to minimize freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during production. If you have a specific tag type preference, please let us know and we will prioritize its implementation in the manufacturing process.
Synonyms
mntP; KPN78578_23020; KPN_02337; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Target Names
mntP
Target Protein Sequence
MNLSATILLAFGMSMDAFAASIGKGATLHKPKFSEAVRTGLIFGAIETLTPLVGWGLGML ASQFILEWNHWIAFILLVFLGGRMIVEGFRGDSDEACEAPHRHGFWLLVTTAFATSLDAM AVGVGLAFLQVSIVTTALAIGCATFIMSTLGMMVGRFIGPLLGKRAEILGGIVLIGIGSE ILWSHFAG
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the UPF0059 membrane protein KPN78578_23020 and what is its significance in Klebsiella pneumoniae?

The UPF0059 membrane protein KPN78578_23020 is a membrane-associated protein found in Klebsiella pneumoniae subsp. pneumoniae. It belongs to the UPF0059 protein family, which consists of uncharacterized proteins of unknown function. The significance of this protein lies in its location within the bacterial membrane, suggesting potential roles in cellular processes such as membrane integrity, transport mechanisms, or signaling pathways. The protein consists of 188 amino acids and has been studied using recombinant expression systems with His-tag modifications to facilitate purification and analysis .

Like many membrane proteins, KPN78578_23020 likely contributes to the structural and functional properties of the bacterial cell membrane, which is crucial for cell survival, antibiotic resistance, and pathogenicity. Understanding this protein's function could provide insights into bacterial membrane biology and potentially identify new targets for antimicrobial therapies against Klebsiella pneumoniae infections.

How is recombinant KPN78578_23020 protein typically expressed and purified for research purposes?

Recombinant KPN78578_23020 protein is typically expressed in E. coli expression systems using plasmid vectors that contain the gene of interest fused to an affinity tag, most commonly a His-tag attached to the N-terminus. The expression system is designed to optimize protein folding and stability while minimizing aggregation, which is particularly challenging for membrane proteins .

The expression process generally follows these methodological steps:

  • Gene cloning into an appropriate expression vector

  • Transformation into a suitable E. coli strain

  • Culture growth under optimized conditions (temperature, media composition, induction timing)

  • Cell harvesting and lysis

  • Membrane fraction isolation

  • Detergent-mediated solubilization of the membrane protein

  • Affinity chromatography using the His-tag

  • Further purification steps such as size exclusion chromatography

Table 1: Typical Expression Conditions for Recombinant KPN78578_23020

ParameterOptimal ConditionNotes
E. coli strainBL21(DE3)Lacks proteases that could degrade the target protein
Growth temperature18-25°CLower temperatures reduce inclusion body formation
Induction0.1-0.5 mM IPTGLower concentrations prevent aggregation
Growth mediaLB or 2xYT with supplementsMedia enriched with glycerol can improve membrane protein expression
Harvest time16-20 hours post-inductionExtended expression time at lower temperatures
Lysis bufferPhosphate buffer with protease inhibitorsMaintains protein stability during extraction

This methodological approach has been shown to yield functional recombinant membrane proteins suitable for structural and functional studies.

What analytical techniques are most effective for characterizing the structural properties of KPN78578_23020?

The structural characterization of membrane proteins like KPN78578_23020 requires a combination of complementary techniques due to their complex nature and challenging properties. Several analytical approaches have proven effective in revealing structural information about membrane proteins, each with specific advantages and limitations.

For primary structure confirmation, mass spectrometry (MS) techniques such as MALDI-TOF or ESI-MS can verify the protein's molecular weight and sequence. Circular dichroism (CD) spectroscopy is particularly valuable for secondary structure assessment, providing information about the alpha-helical content typical of transmembrane domains. For tertiary structure determination, X-ray crystallography remains the gold standard when crystals can be obtained, while cryo-electron microscopy (cryo-EM) has emerged as a powerful alternative that doesn't require crystallization.

Nuclear magnetic resonance (NMR) spectroscopy can provide detailed structural information in solution, though size limitations make this challenging for larger membrane proteins. Newer techniques like hydrogen-deuterium exchange mass spectrometry (HDX-MS) can reveal dynamic structural aspects and protein-ligand interactions.

Table 2: Analytical Techniques for Structural Characterization of Membrane Proteins

TechniqueApplicationAdvantagesLimitations
SDS-PAGEPurity assessment, molecular weight estimationSimple, widely accessibleLimited resolution, denatures proteins
Western blottingSpecific protein identificationHigh specificity using antibodiesQualitative rather than quantitative
Circular dichroismSecondary structure analysisRequires small amounts of sample, works in solutionLow resolution, cannot determine precise structure
X-ray crystallographyHigh-resolution 3D structureAtomic-level resolutionRequires protein crystallization, challenging for membrane proteins
Cryo-EMHigh-resolution 3D structureNo crystallization requiredRequires specialized equipment, complex data processing
NMR spectroscopy3D structure in solution, dynamicsInformation on protein dynamicsSize limitations, requires isotope labeling
HDX-MSProtein dynamics, conformational changesWorks with complex samples, no size limitationModerate resolution, requires careful sample preparation

When applying these techniques to KPN78578_23020, researchers should consider the membrane environment's importance and may utilize detergent micelles, nanodiscs, or liposomes to maintain the protein's native conformation during analysis .

How can researchers effectively design experiments to investigate the membrane permeability effects of KPN78578_23020?

Investigating the membrane permeability effects of KPN78578_23020 requires carefully designed experiments that can accurately measure changes in membrane properties while controlling for variables that might influence results. Researchers should consider a multi-phase experimental approach that combines in vitro reconstitution systems with cellular studies.

A comprehensive experimental design would begin with liposome-based assays where purified KPN78578_23020 is reconstituted into artificial lipid bilayers containing fluorescent dyes or other reporter molecules. These systems allow researchers to measure changes in membrane permeability under controlled conditions by monitoring the movement of specific molecules across the membrane. Varying lipid compositions in these liposomes can help determine how the protein interacts with different membrane environments.

Following in vitro studies, researchers should transition to cellular models, potentially using both bacterial cells expressing or lacking the protein, and model cell lines for eukaryotic membrane studies. As described in the literature on membrane permeability experiments, controlling for variables such as temperature, pH, and experimental timing is crucial for obtaining reliable results .

Table 3: Experimental Approach for Investigating Membrane Permeability

Experimental SystemMethodologyMeasurementsControls
Liposome leakage assayReconstitution of purified protein in liposomes containing fluorescent dyesFluorescence spectroscopy to measure dye leakageProtein-free liposomes, heat-denatured protein
Ion flux measurementsReconstitution in planar lipid bilayersElectrophysiology to measure conductance changesEmpty membranes, known channel proteins
Bacterial growth assaysExpression in bacterial strainsGrowth rates in various conditionsEmpty vector controls, complementation analysis
Fluorescent probe studiesIncorporation of environment-sensitive probesChanges in fluorescence spectraBaseline measurements before protein addition
Temperature-dependent studiesVariable temperature experimentsPermeability at different temperaturesMeasurements at standardized intervals and conditions

When designing these experiments, researchers should be particularly attentive to temperature control, as membrane fluidity and permeability are highly temperature-dependent. Studies indicate that both high and low temperatures can significantly affect membrane integrity, potentially confounding the specific effects of the membrane protein being studied .

What are the methodological challenges in resolving contradictory data from KPN78578_23020 functional studies and how can they be addressed?

Resolving contradictory data in functional studies of membrane proteins like KPN78578_23020 presents significant methodological challenges that require systematic approaches to address. Contradictions frequently arise from variations in experimental conditions, protein preparation methods, lipid environments, and analytical techniques.

One primary challenge is ensuring the protein's native conformation during purification and experimentation. Membrane proteins often lose functionality when removed from their lipid environment, leading to inconsistent results. Researchers should employ detergent screening to identify conditions that maintain protein stability and function, followed by validation using multiple complementary techniques such as circular dichroism and functional assays.

Another source of contradictory data stems from different expression systems. KPN78578_23020 expressed in E. coli may have different post-translational modifications or folding characteristics compared to the native protein in Klebsiella pneumoniae. Testing the protein expressed in multiple systems and comparing their functional properties can help identify system-specific artifacts.

Table 4: Strategies for Resolving Contradictory Data in Membrane Protein Research

ChallengeResolution StrategyImplementationValidation Approach
Protein denaturation during purificationDetergent optimizationScreen multiple detergents and stabilizing agentsCircular dichroism to confirm secondary structure
Expression system artifactsMulti-system comparisonExpress protein in different hosts (E. coli, yeast, insect cells)Comparative functional assays across systems
Lipid environment variationsStandardized reconstitutionDefine precise lipid compositions for reconstitutionMicroscopy to confirm proper incorporation
Assay-dependent resultsMulti-technique validationApply complementary functional assaysCorrelation analysis between different measurements
Sample heterogeneityImproved purificationAdd additional chromatography stepsSize-exclusion chromatography with multi-angle light scattering
Batch-to-batch variationStandardized protocolsDevelop detailed SOPs for protein preparationQuality control checkpoints throughout preparation

To systematically address data contradictions, researchers should implement rigorous statistical analysis using appropriate tests for the data type and distribution. When presenting research results, following standard guidelines for data presentation is crucial, including proper reporting of statistical methods, sample sizes, and measures of variation .

How does the membrane environment affect the structural stability and function of KPN78578_23020, and what methods can assess these interactions?

The membrane environment plays a critical role in determining the structural stability and function of membrane proteins like KPN78578_23020. Lipid composition, membrane fluidity, thickness, charge distribution, and lateral pressure all influence protein folding, stability, and functional behavior. Understanding these interactions requires specialized methodologies that can probe the protein-lipid interface while maintaining the integrity of the membrane system.

The hydrophobic mismatch between the protein's transmembrane domains and the lipid bilayer thickness can induce conformational changes that affect function. Similarly, specific lipid-protein interactions may be required for optimal activity, particularly if the protein functions as part of a larger complex or requires lipid cofactors. These interactions can be investigated using a combination of biophysical and biochemical approaches.

Fluorescence spectroscopy using environment-sensitive probes can detect conformational changes in response to different lipid environments. Site-directed spin labeling coupled with electron paramagnetic resonance (EPR) spectroscopy provides information about local dynamics and accessibility of specific protein regions in the membrane. Molecular dynamics simulations complement experimental approaches by predicting how the protein behaves in different membrane environments over time.

Table 5: Methods for Assessing Protein-Membrane Interactions

MethodInformation ObtainedTechnical ApproachData Analysis
Differential scanning calorimetryThermal stability in different lipid environmentsMeasure heat capacity changes during protein unfoldingTransition temperature comparison across conditions
Fluorescence spectroscopyLocal environmental changes, protein dynamicsIntrinsic tryptophan fluorescence or extrinsic probesEmission spectrum shifts, quenching analysis
FRETProtein-lipid proximity, conformational changesDonor-acceptor fluorophore pairsEnergy transfer efficiency calculations
Neutron reflectometryMembrane insertion depth, orientationNeutron scattering at interfacesScattering length density profile fitting
Solid-state NMRProtein orientation, dynamics in membraneMagic angle spinning NMR of labeled proteinChemical shift analysis, dipolar coupling measurements
Molecular dynamics simulationsAtomistic interactions, dynamic behaviorComputational modeling of protein-lipid systemTrajectory analysis, energy calculations

Temperature-dependent studies are particularly valuable, as they can reveal how membrane fluidity affects protein function. Cell membrane experiments have shown that temperature significantly impacts membrane permeability, with higher temperatures typically increasing fluidity and permeability . By systematically varying temperature while monitoring KPN78578_23020 function, researchers can determine the optimal membrane environment for protein activity and identify potential regulatory mechanisms.

What are the optimal conditions for expressing and purifying KPN78578_23020 to maintain its native conformation and function?

Expressing and purifying membrane proteins like KPN78578_23020 while maintaining their native conformation presents significant challenges that require carefully optimized protocols. The hydrophobic nature of membrane proteins makes them prone to misfolding, aggregation, and loss of function during expression and purification processes. Based on research with similar membrane proteins, several key factors have been identified that contribute to successful outcomes.

Induction parameters must be carefully controlled, with lower IPTG concentrations (0.1-0.3 mM) often producing better results than standard concentrations. The membrane extraction and solubilization steps are particularly critical for maintaining native conformation. A two-step extraction process is recommended: first isolating the membrane fraction through differential centrifugation, then solubilizing the protein using mild detergents.

Table 6: Optimization Parameters for KPN78578_23020 Expression and Purification

StageParameterRecommended ConditionsRationale
Vector designAffinity tagN-terminal His6 tag with TEV cleavage siteFacilitates purification while allowing tag removal
Expression strainE. coli variantBL21(DE3) pLysSReduces leaky expression and provides better control
Growth phaseInduction timingOD600 of 0.6-0.8Cells in mid-log phase have optimal membrane capacity
Expression conditionsTemperature18°C post-inductionSlows expression, improves folding
Duration16-20 hoursExtended time compensates for slower expression
MediaTB with 0.5% glucoseRich media supports membrane formation
Membrane isolationLysis methodGentle enzymatic lysis with lysozymePreserves membrane integrity
Buffer composition50 mM Tris pH 8.0, 200 mM NaCl, 10% glycerolStabilizes membranes during isolation
SolubilizationDetergent selectionDDM, LMNG, or MNG-3 at 1%Mild detergents preserve protein structure
Solubilization time2 hours at 4°CSufficient for extraction while minimizing denaturation
PurificationChromatography sequenceIMAC followed by SECRemoves aggregates and impurities
Buffer compositionDetergent at CMC + 0.05%Maintains micelle without excess detergent

For long-term storage and functional studies, detergent exchange or reconstitution into lipid nanoparticles such as nanodiscs or liposomes is recommended. This approach provides a more native-like environment than detergent micelles and has been shown to better preserve membrane protein activity and structure .

How can researchers establish reliable assays to measure the functional activity of KPN78578_23020?

Establishing reliable functional assays for membrane proteins like KPN78578_23020 requires a thorough understanding of the protein's potential roles and careful consideration of appropriate experimental systems. Since UPF0059 family proteins have uncharacterized functions, a multi-faceted approach combining bioinformatic predictions with diverse experimental techniques is necessary to develop informative assays.

Bioinformatic analysis should be the first step in assay development, using tools like TMHMM for transmembrane domain prediction, InterPro for domain identification, and homology modeling to identify potential functional regions. These predictions can guide the design of targeted functional assays based on structural similarities with better-characterized proteins. Parallel expression of the protein in multiple systems (bacterial, yeast, and mammalian cells) can help identify cellular phenotypes associated with the protein's presence or absence.

For membrane proteins, transport function is a common possibility that should be investigated using liposome-based assays. Reconstituting purified KPN78578_23020 into liposomes loaded with fluorescent dyes or radiolabeled compounds allows researchers to measure potential transport activity by monitoring substrate movement across the membrane. Ion channel function can be assessed using electrophysiological techniques such as patch-clamp recording or planar lipid bilayer systems.

Table 7: Functional Assay Development for KPN78578_23020

Potential FunctionAssay TypeMethodologyData Analysis Approach
Ion transportFluorescence-based flux assayProtein reconstitution in liposomes with ion-sensitive dyesFluorescence intensity change over time
Substrate bindingIsothermal titration calorimetryMeasure heat changes during bindingBinding affinity (Kd) determination
Enzyme activityCoupled enzyme assaysMonitor product formation through linked reactionsEnzyme kinetics parameters (Km, Vmax)
Protein-protein interactionPull-down assays and crosslinkingIdentify interaction partners in membrane fractionsMass spectrometry identification
Membrane integrityPermeability assaysSimilar to beetroot permeability experimentsColorimetric measurement of leakage
Structural changesThermal shift assaysProtein stability in different conditionsMelting temperature determination

When developing these assays, rigorous controls are essential. These should include protein-free liposomes, heat-inactivated protein samples, and well-characterized membrane proteins with known functions as positive controls. Statistical validation of assay reproducibility should follow standard scientific practices, with appropriate replication and statistical tests as described in research data presentation guidelines . Temperature-dependent studies may be particularly informative, as membrane protein function often shows strong temperature dependence due to effects on both protein dynamics and membrane fluidity .

What approaches can researchers use to investigate the role of KPN78578_23020 in bacterial membrane permeability and antibiotic resistance?

Investigating the role of KPN78578_23020 in bacterial membrane permeability and antibiotic resistance requires a comprehensive experimental approach that combines genetic manipulation, membrane permeability assays, and antibiotic susceptibility testing. The potential connection between membrane proteins and antibiotic resistance is particularly relevant given the rising concern about resistant Klebsiella pneumoniae strains in clinical settings.

Genetic approaches provide the foundation for functional studies, starting with gene knockout or knockdown strategies to create strains lacking KPN78578_23020. CRISPR-Cas9 systems adapted for Klebsiella pneumoniae or traditional homologous recombination methods can generate clean deletions, while antisense RNA or CRISPRi approaches offer tunable knockdown alternatives. Complementation studies, where the wild-type gene is reintroduced, confirm that observed phenotypes result directly from the absence of the target protein rather than polar effects or compensatory mutations.

Membrane permeability can be assessed using multiple complementary techniques. Fluorescent dye uptake assays using molecules like propidium iodide, which only penetrates cells with compromised membranes, provide a direct measure of permeability. The beetroot membrane permeability experimental approach described in the literature offers a model for designing similar assays with bacterial cells, using appropriate indicators for bacterial membranes .

Table 8: Experimental Approaches for Studying KPN78578_23020 in Antibiotic Resistance

ApproachMethodologyMeasurementsData Interpretation
Gene knockoutCRISPR-Cas9 or homologous recombinationVerification by PCR and sequencingConfirmation of clean deletion
Antibiotic susceptibilityMinimum inhibitory concentration (MIC) assaysMIC values for multiple antibioticsFold-change compared to wild-type
Membrane permeabilityFluorescent dye uptake assaysFluorescence intensity over timeRate of dye accumulation
Outer membrane integrityNPN assayFluorescence increase upon membrane disruptionRelative membrane stability
Efflux pump activityEthidium bromide accumulationFluorescence in presence/absence of efflux inhibitorsEfflux rate calculation
Lipidomic analysisMass spectrometry of membrane lipidsLipid composition changesCorrelation with permeability changes
Gene expressionRNA-seq of knockout vs. wild-typeDifferential gene expressionIdentification of compensatory pathways

Antibiotic susceptibility testing should include a panel of antibiotics with different mechanisms of action, particularly those targeting cell walls, protein synthesis, and DNA replication. Changes in susceptibility patterns between wild-type and knockout strains can reveal whether KPN78578_23020 affects specific resistance mechanisms. Time-kill kinetics, which measure bacterial killing rates over time, provide more detailed information than endpoint MIC determinations.

Temperature-dependent studies are particularly informative for membrane-related functions, as membrane fluidity and permeability change significantly with temperature . Comparing wild-type and knockout strains across a temperature range can reveal whether KPN78578_23020 plays a role in adapting membrane properties to environmental conditions, potentially contributing to survival in host environments.

What statistical approaches are most appropriate for analyzing experimental data related to KPN78578_23020 function?

For comparative studies examining differences between wild-type and mutant proteins or varying experimental conditions, the choice between parametric and non-parametric tests depends on data distribution. Researchers should first assess normality using Shapiro-Wilk or Kolmogorov-Smirnov tests, then select appropriate statistical tests. For normally distributed data, t-tests (paired or unpaired) or ANOVA (for multiple comparisons) are suitable, while non-parametric alternatives like Mann-Whitney U or Kruskal-Wallis tests should be employed for non-normal distributions.

Dose-response experiments, common in transport or binding studies, require regression analysis to determine parameters like EC50 or Kd values. Nonlinear regression models based on relevant biological equations (Hill equation, Michaelis-Menten kinetics) provide more meaningful parameters than simple curve fitting. For time-course experiments measuring membrane permeability or transport kinetics, area under the curve (AUC) analysis or rate calculations may be more informative than endpoint measurements.

Table 9: Statistical Approaches for Different Experimental Designs

Experimental DesignData TypeRecommended Statistical ApproachReporting Parameters
Comparison of two conditionsContinuous, normalUnpaired t-testMean difference, p-value, 95% CI
Comparison of two conditionsContinuous, non-normalMann-Whitney U testMedian difference, p-value
Multiple conditionsContinuous, normalOne-way ANOVA with post-hoc testsF-statistic, p-value, effect size
Multiple conditions with multiple variablesContinuousTwo-way ANOVAMain effects, interactions, p-values
Dose-response experimentsContinuousNonlinear regression (Hill equation)EC50, Hill coefficient, R²
Time-course experimentsContinuous, repeated measuresMixed-effects modelFixed and random effects, p-values
Correlation between variablesContinuousPearson or Spearman correlationCorrelation coefficient, p-value
Multivariate analysisMultiple variablesPrincipal component analysisVariance explained, component loadings

When reporting statistical results, researchers should follow best practices as outlined in scientific data presentation guidelines . This includes reporting exact p-values rather than threshold statements (e.g., p<0.05), providing measures of variability (standard deviation or standard error), and clearly stating sample sizes. Statistical significance should be distinguished from biological significance, with effect sizes reported alongside p-values to provide context for the magnitude of observed differences.

For complex datasets involving multiple variables, multivariate statistical approaches like principal component analysis (PCA) or partial least squares discriminant analysis (PLS-DA) can help identify patterns and relationships that might not be apparent in univariate analyses. These approaches are particularly valuable for lipidomic or proteomic studies investigating how KPN78578_23020 affects the broader membrane environment.

How can researchers effectively present complex data on KPN78578_23020 structure-function relationships in scientific publications?

Effectively presenting complex structure-function data on membrane proteins like KPN78578_23020 requires thoughtful organization, appropriate visualization techniques, and clarity in communication. The goal is to make sophisticated scientific findings accessible to other researchers while maintaining scientific rigor and accuracy.

Data visualization is crucial for complex structure-function relationships. Different types of data require different visualization approaches. Structural data is best presented using molecular graphics showing relevant features like transmembrane domains, binding sites, or conformational changes. These should be created using standard molecular visualization software and presented with clear labeling, appropriate coloring schemes, and multiple views if necessary. Functional data often involves time courses, dose-responses, or comparative measurements that are best visualized using line graphs, bar charts, or scatter plots depending on the specific data type.

Table 10: Effective Data Presentation Strategies for Structure-Function Studies

Data TypeVisualization MethodBest PracticesCommon Pitfalls to Avoid
Protein structureRibbon/cartoon diagramsHighlight functional regions with distinct colorsOverly complex views with too many elements
Sequence-function correlationsDomain maps with activity dataAlign functional data with sequence featuresDisconnected presentation of sequence and functional data
Mutagenesis resultsBar charts with statistical indicatorsGroup mutations by region or typeUsing inconsistent scales across different mutants
Kinetic dataLine graphs with fitted curvesInclude residuals plot for fit qualityOverextending fitted curves beyond measured data
Binding studiesSaturation curves with Scatchard plotsShow raw data points with fitted curvesExcluding outliers without explanation
Membrane integrationCross-section diagramsInclude membrane boundariesAmbiguous positioning relative to membrane
Multiple experimental approachesCombination figures with labeled panelsUse consistent formatting across panelsOvercrowding with too many panels

Tables are particularly effective for presenting comparative data across multiple conditions or mutants. When designing tables, researchers should follow the principles outlined in scientific publishing guidelines: keep titles brief but informative, use consistent units and decimal places, and employ footnotes to define abbreviations or describe statistical analyses . Complex datasets with multiple variables might benefit from heat maps or correlation matrices that visually represent relationships between parameters.

Statistical analysis should be presented with appropriate detail, including specific tests used, p-values, and measures of variation such as standard deviation or confidence intervals. Statistical significance can be indicated using conventional symbols (*, †, ‡) with clear definitions in figure legends or footnotes . When presenting scientific data, it's important to round numbers appropriately to avoid implying greater precision than is justified by the methodology.

What bioinformatic tools and databases are most valuable for analyzing the evolutionary and functional context of KPN78578_23020?

Bioinformatic analysis provides crucial context for experimental studies of KPN78578_23020 by revealing evolutionary relationships, predicting functional domains, and identifying potential interaction partners. A comprehensive bioinformatic approach integrates multiple tools and databases to generate testable hypotheses about the protein's function and significance in Klebsiella pneumoniae biology.

Sequence analysis forms the foundation of bioinformatic investigation. Primary sequence databases like UniProt provide curated information about KPN78578_23020 and related proteins, while BLAST searches against comprehensive databases identify homologs across bacterial species. Multiple sequence alignment tools like Clustal Omega or MUSCLE reveal conserved residues that likely play important functional or structural roles. Phylogenetic analysis using maximum likelihood or Bayesian methods can then establish evolutionary relationships between KPN78578_23020 and homologs in other bacteria, potentially revealing functional divergence or conservation.

Structural prediction tools are particularly valuable for membrane proteins, which are often underrepresented in structural databases. Transmembrane topology prediction tools like TMHMM or Phobius identify membrane-spanning regions, while newer deep learning approaches like AlphaFold provide increasingly accurate structural models even for proteins with limited homology to solved structures. These predictions can guide experimental design by highlighting potential functional sites for mutagenesis or suggesting conformational dynamics.

Table 11: Bioinformatic Resources for KPN78578_23020 Analysis

Analysis TypeRecommended Tools/DatabasesApplicationOutput Interpretation
Sequence retrievalUniProt, NCBI ProteinObtain curated sequence dataReview annotation status and evidence
Homology searchBLAST, HMMERIdentify related proteinsE-values indicate significance of matches
Multiple sequence alignmentClustal Omega, MUSCLE, T-CoffeeIdentify conserved regionsConservation patterns suggest functional sites
Phylogenetic analysisMEGA, RAxML, MrBayesEstablish evolutionary relationshipsTree topology reveals evolutionary history
Domain predictionInterPro, Pfam, SMARTIdentify functional domainsDomain architecture suggests function
Transmembrane topologyTMHMM, Phobius, TOPCONSPredict membrane-spanning regionsNumber and position of transmembrane helices
3D structure predictionAlphaFold, I-TASSER, SWISS-MODELGenerate structural modelsModel quality scores indicate reliability
Protein-protein interactionSTRING, IntActPredict interaction partnersConfidence scores and experimental evidence
Genomic contextKEGG, BioCycIdentify operons and metabolic pathwaysGene neighborhood suggests functional relationships
Subcellular localizationPSORTb, CELLOConfirm membrane localizationProbability scores for different localizations

Functional context can be derived from genomic neighborhood analysis using tools like KEGG or BioCyc, which identify genes commonly co-located or co-transcribed with KPN78578_23020. These associations often suggest functional relationships, particularly in bacteria where genes with related functions are frequently organized in operons. Protein-protein interaction databases like STRING integrate experimental data with predictive approaches to identify potential interaction partners, providing clues about the protein's role in larger cellular processes.

For the UPF0059 protein family, which includes uncharacterized proteins, comparative genomics approaches are particularly valuable. By examining the presence, absence, or variation of these proteins across bacterial species with different phenotypes (such as antibiotic resistance profiles or virulence characteristics), researchers can generate hypotheses about their functional significance. These hypotheses can then guide experimental approaches, creating a productive cycle between bioinformatic prediction and laboratory validation.

How are emerging technologies improving our ability to study membrane proteins like KPN78578_23020?

Emerging technologies are revolutionizing membrane protein research, overcoming traditional challenges in expression, purification, structural determination, and functional characterization. These advances create new opportunities for studying proteins like KPN78578_23020 with unprecedented detail and accuracy, potentially revealing functions that have remained elusive with conventional approaches.

Recent developments in structural biology have transformed our ability to visualize membrane proteins. Cryo-electron microscopy (cryo-EM) has undergone a "resolution revolution," now routinely achieving near-atomic resolution without the need for protein crystallization, which has traditionally been a major bottleneck for membrane proteins. This technology allows researchers to visualize proteins in more native-like environments and capture multiple conformational states. Complementary approaches like serial femtosecond crystallography using X-ray free-electron lasers (XFELs) enable structure determination from microcrystals at room temperature, potentially revealing physiologically relevant conformations that might be altered in traditional cryogenic methods.

Expression systems have evolved beyond conventional E. coli approaches, with cell-free systems emerging as powerful alternatives for difficult membrane proteins. These systems bypass cellular toxicity issues and allow direct incorporation of non-canonical amino acids for specialized studies. Nanoscale membrane mimetics, including nanodiscs, styrene-maleic acid lipid particles (SMALPs), and amphipols, provide more native-like environments than detergent micelles, better preserving protein structure and function during purification and analysis.

Table 12: Emerging Technologies for Membrane Protein Research

TechnologyApplication to KPN78578_23020AdvantagesCurrent Limitations
Single-particle cryo-EMHigh-resolution structural determinationNo crystallization required, multiple conformationsStill challenging for small (<100 kDa) proteins
AlphaFold and deep learningStructure predictionAccurate predictions even with limited homologyMembrane environment not explicitly modeled
Cell-free expression systemsDifficult-to-express membrane proteinsRapid production, direct incorporation of labelsHigher cost than cellular systems
Native mass spectrometryIntact protein complexes with lipidsPreserves non-covalent interactionsSpecialized equipment and expertise required
Nanodiscs and SMALPsExtraction in native lipid environmentMaintains annular lipids and protein interactionsSample heterogeneity challenges
Single-molecule FRETConformational dynamicsReal-time measurement of structural changesRequires strategic fluorophore placement
Advanced EPR techniquesLocal environment and dynamicsSensitive to membrane interactionsLimited to sites with spin labels
Microfluidic platformsHigh-throughput functional screeningMinimal sample consumption, parallel testingComplex device fabrication
CRISPR interferenceTunable gene knockdownPrecise targeting, titratable expressionVariable efficiency across organisms

Functional characterization has been enhanced by single-molecule techniques that reveal previously inaccessible details about protein behavior. Single-molecule fluorescence resonance energy transfer (smFRET) captures conformational dynamics in real-time, while high-speed atomic force microscopy (HS-AFM) visualizes topographical changes during function. Microfluidic platforms enable high-throughput screening of conditions or ligands with minimal sample consumption, accelerating functional discovery for uncharacterized proteins like KPN78578_23020.

Computational approaches have advanced in parallel with experimental techniques. Molecular dynamics simulations now routinely reach microsecond to millisecond timescales, capturing functionally relevant conformational changes. Enhanced sampling methods and specialized force fields for membrane environments improve the accuracy of these simulations. Machine learning approaches like AlphaFold have dramatically improved structure prediction, providing valuable starting models for experimental validation and guiding hypothesis generation for proteins like KPN78578_23020 with limited experimental data.

What are the most promising research directions for elucidating the function of uncharacterized membrane proteins in the UPF0059 family?

Uncharacterized protein families like UPF0059, which includes KPN78578_23020, present both challenges and opportunities for researchers. Elucidating their functions requires integrated approaches that combine computational predictions, high-throughput screening, and targeted experimental validation. Several promising research directions have emerged that could accelerate functional discovery for these enigmatic proteins.

Systems biology approaches offer a powerful strategy for contextualizing uncharacterized proteins within cellular networks. Multi-omics studies integrating transcriptomics, proteomics, and metabolomics can reveal how UPF0059 proteins respond to different conditions or stressors, potentially linking them to specific cellular processes. Correlation analysis between protein expression patterns and phenotypic outcomes across multiple conditions can generate functional hypotheses for experimental testing. Genetic interaction mapping using techniques like synthetic genetic arrays or CRISPRi screens can identify genes that functionally interact with UPF0059 family members, revealing pathways they may participate in.

Structural biology remains fundamental to functional elucidation. Beyond determining static structures, characterizing conformational dynamics and potential ligand binding sites can provide crucial clues about function. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map regions of conformational flexibility or stability, while fragment-based screening approaches can identify small molecules that interact with the protein, potentially revealing binding pockets with functional significance.

Table 13: Promising Research Directions for UPF0059 Family Proteins

Research DirectionMethodological ApproachExpected InsightsIntegration with Other Approaches
Evolutionary profilingPhylogenetic pattern analysisFunctional associations based on co-evolutionGuides targeted mutagenesis of conserved residues
High-throughput phenotypingBiolog phenotype microarraysGrowth patterns under diverse conditionsIdentifies conditions for focused mechanistic studies
Chemical geneticsSmall molecule screeningCompounds that alter protein functionProvides tools for acute functional perturbation
Interactome mappingProximity labeling (BioID, APEX)Protein interaction partners in native contextReveals complexes and functional associations
In vivo crosslinkingPhoto-crosslinking amino acidsCapture of transient interactionsIdentifies substrates for transporters or enzymes
Lipidomic analysisMass spectrometry of membrane lipidsLipid compositional changes in mutantsLinks protein to membrane homeostasis
Comparative genomicsCo-occurrence patternsSpecies-specific adaptationsCorrelates with ecological or pathogenic niches
Condition-specific essentialityCRISPRi under stress conditionsContexts where protein becomes criticalReveals potential functions under specific stresses
Structural dynamicsSingle-molecule techniquesConformational states and transitionsConnects structure to potential mechanisms

For bacterial membrane proteins like KPN78578_23020, investigating their role in stress responses and environmental adaptation is particularly promising. Bacteria must constantly adjust their membrane properties to survive changing conditions, and uncharacterized membrane proteins may play important roles in these adaptations. Comparing wild-type and knockout strains under various stressors (temperature extremes, osmotic shock, pH changes, antimicrobial compounds) can reveal condition-specific phenotypes that provide functional insights. Temperature-dependent studies are especially relevant given the known importance of temperature in membrane fluidity and permeability .

Cross-species comparative studies offer another valuable avenue. By examining how UPF0059 family proteins vary across bacterial species with different ecological niches or pathogenic capabilities, researchers can identify correlations between protein features and bacterial lifestyles. These correlations can suggest potential functions related to specific environmental adaptations or virulence mechanisms, particularly relevant for Klebsiella pneumoniae as an opportunistic pathogen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.