Recombinant Klebsiella pneumoniae subsp. pneumoniae UPF0060 membrane protein KPN78578_15550 (KPN78578_15550)

Shipped with Ice Packs
In Stock
Cat. No.
BT2505798
Source
in vitro E.coli expression system
Synonyms
KPN78578_15550; KPN_01585; UPF0060 membrane protein KPN78578_15550
Quick Inquiry

Description

Expression and Purification

  • Host Organism: E. coli

  • Form: Lyophilized powder, stored at -20°C/-80°C

  • Stability: Avoid repeated freeze-thaw cycles; working aliquots stable at 4°C for ≤1 week

Key Technical Considerations

  • Reconstitution: Briefly centrifuge vials before opening; dissolve in sterile water with glycerol for long-term storage

  • Compatibility: Optimized for downstream applications like ELISA, Western blot, or structural studies

Proposed Roles

While specific biological functions remain under investigation, its classification as a UPF0060 family protein suggests involvement in:

  1. Membrane-Associated Processes: Likely roles in transport, signaling, or pathogen-host interactions

  2. Pathogenicity: K. pneumoniae membrane proteins often contribute to virulence, adhesion, or antibiotic resistance

Research Applications

ApplicationDescription
Structural StudiesX-ray crystallography/NMR for 3D structure determination
Antigen StudiesELISA-based detection of antibodies in clinical/pathological samples
Infectious Disease ModelingInvestigating hypervirulent K. pneumoniae (hvKp) pathotypes

Comparative Analysis with Related Proteins

ParameterKPN78578_15550General GPCRs (e.g., studied in )
SolubilityRequires detergents (His-tag)Engineered variants for solubility
Expression HostE. coliMammalian systems (for GPCRs)
Membrane IntegrationCotranslational (predicted)Post-translational (observed in EmrE)

Limitations and Future Directions

  1. Functional Data Gaps: No direct evidence of enzymatic activity or binding partners

  2. Structural Challenges: Hydrophobic regions may hinder crystallization; require solubility-enhancing mutations

  3. Pathogenic Relevance: Requires correlation with K. pneumoniae clinical isolates (e.g., ST-15, ST-258 clones)

References and Databases

  • UniProt: A6T8U5 (KPN78578_15550)

  • MLST Databases: BIGSdb-Pasteur for K. pneumoniae genotyping

  • Commercial Sources: Creative BioMart (Cat. RFL15103KF), CBM15 (ELISA kits)

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
KPN78578_15550; KPN_01585; UPF0060 membrane protein KPN78578_15550
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Target Names
KPN78578_15550
Target Protein Sequence
MLKTTLLFFATALCEIVGCYLPWLWLKRGATPLLLIPTALALALFVWLLTLHPAASGRVY AAYGGVYVCTALLWLRVVDGVKLTHYDWAGAAIALCGMLIIVAGWGRA
Uniprot No.
A6T8U5

Target Background

Database Links

KEGG: kpn:KPN_01585

STRING: 272620.KPN_01585

Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.