Recombinant Klebsiella pneumoniae subsp. pneumoniae UPF0208 membrane protein KPN78578_26420 (KPN78578_26420)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates. Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process. The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
KPN78578_26420; KPN_02686; UPF0208 membrane protein KPN78578_26420
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Target Names
KPN78578_26420
Target Protein Sequence
MSTPEKRPVSFFSLFNRGQHYAKTWPLDKRLAPVFIENRIIRATRYAIRIMPPIAIFTLC WQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPSILNWFYEVRGKLQEAGQAL APVEGKPDYQALADTLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links
Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of KPN78578_26420 membrane protein?

KPN78578_26420 is a UPF0208 membrane protein from Klebsiella pneumoniae subsp. pneumoniae with a full-length sequence of 151 amino acids. The protein can be expressed with a His-tag to facilitate purification and characterization . For structural analysis, researchers should consider both experimental approaches (X-ray crystallography, cryo-EM) and computational predictions using modern tools like AlphaFold. Recent advancements in protein structure prediction have significantly improved our ability to model membrane proteins, which has traditionally been challenging due to their hydrophobic domains .

What expression systems are recommended for recombinant production of KPN78578_26420?

E. coli is the primary expression system used for recombinant production of KPN78578_26420 . When expressing this membrane protein, researchers should optimize protocols by:

  • Testing multiple E. coli strains (BL21(DE3), C41(DE3), C43(DE3))

  • Adjusting induction conditions (IPTG concentration, temperature, induction time)

  • Adding membrane protein-specific solubilizing agents

  • Using specialized vectors with regulated promoters

For challenging membrane proteins like KPN78578_26420, lower expression temperatures (16-20°C) often improve proper folding and membrane insertion. Extraction requires appropriate detergents, with optimization necessary to maintain native conformation.

How can the purity and integrity of isolated KPN78578_26420 be assessed?

Purified KPN78578_26420 can be assessed through:

  • SDS-PAGE with Coomassie staining to verify molecular weight (expected ~17kDa plus tag)

  • Western blotting with anti-His antibodies

  • Size exclusion chromatography to evaluate oligomeric state

  • Circular dichroism to assess secondary structure

  • Mass spectrometry for amino acid sequence verification

A multi-method approach is recommended as single techniques may provide misleading results for membrane proteins, which can aggregate or unfold during purification protocols.

What methodologies are suitable for determining the cellular localization of KPN78578_26420?

To confirm the membrane localization of KPN78578_26420, researchers should employ multiple complementary approaches:

  • Cellular fractionation: Separate membrane, cytoplasmic, and periplasmic fractions of K. pneumoniae, followed by immunoblotting

  • Fluorescence microscopy: Express KPN78578_26420 fused to fluorescent proteins (GFP variants)

  • Immunoelectron microscopy: Use gold-conjugated antibodies against KPN78578_26420

  • Protease accessibility assays: Determine topology by selective proteolytic digestion

  • Computational topology prediction: Tools like TMHMM, Phobius, and TOPCONS

These approaches should be used in combination, as membrane protein localization can be affected by experimental conditions and overexpression artifacts.

How can potential binding partners of KPN78578_26420 be identified?

Several complementary approaches are recommended for identifying KPN78578_26420 interaction partners:

  • Co-immunoprecipitation: Using antibodies against KPN78578_26420 or its His-tag

  • Bacterial two-hybrid screening: Adapted for membrane proteins

  • Proximity labeling: BioID or APEX2 fusions to tag nearby proteins

  • Cross-linking mass spectrometry: To capture transient interactions

  • Pull-down assays: Using purified KPN78578_26420 as bait

For membrane proteins, interactions are often affected by the lipid environment, so experiments in detergent micelles, nanodiscs, or reconstituted liposomes may yield different results. Similar methodologies have been applied to other membrane proteins in K. pneumoniae for interactome studies, as seen with outer membrane proteins involved in pathogenesis .

What approaches can be used to investigate the potential role of KPN78578_26420 in K. pneumoniae pathogenesis?

To investigate the role of KPN78578_26420 in pathogenesis:

  • Gene deletion studies: Create knockout mutants using CRISPR-Cas or homologous recombination

  • Complementation assays: Restore function to confirm phenotype specificity

  • Animal infection models: Compare virulence of wild-type and mutant strains

  • Host cell interaction assays: Adherence, invasion, and survival in host cells

  • Transcriptomic analysis: RNA-seq to identify differentially expressed genes

  • Immune response evaluation: Measure host cytokine production, immune cell recruitment

These approaches should be systematically applied, similar to studies with other K. pneumoniae outer membrane proteins that have been evaluated as vaccine candidates .

What molecular dynamics (MD) simulation parameters are crucial when modeling KPN78578_26420 in a lipid bilayer?

MD simulations of KPN78578_26420 require specific considerations:

  • Selection of force field: CHARMM36m or AMBER lipid14 are recommended for membrane proteins

  • Appropriate lipid composition: Match the bacterial inner membrane (phosphatidylethanolamine, phosphatidylglycerol, cardiolipin)

  • System equilibration: Extended equilibration (>100ns) to allow proper protein-lipid interactions

  • Production runs: Minimum 1μs to capture relevant conformational changes

  • Analysis parameters: Focus on protein stability, lipid interactions, water penetration, and conformational changes

Modern computational resources now allow microsecond-long simulations of membrane protein systems with 10⁵-10⁶ atoms within weeks . Analysis should examine electrostatic properties and pore characteristics if KPN78578_26420 forms a channel.

Simulation ParameterRecommended SettingRationale
Simulation boxHexagonal prismMinimizes artifacts from periodic boundaries
Water modelTIP3PCompatible with biomolecular force fields
Ion concentration0.15M KClMimics physiological conditions
Temperature310KPhysiological temperature
Pressure couplingSemi-isotropicAllows membrane fluctuations
Timestep2fsStability with constrained bonds

How can we experimentally determine the membrane topology of KPN78578_26420?

Membrane topology of KPN78578_26420 can be determined through:

  • Cysteine scanning mutagenesis: Introduce cysteines and probe accessibility with membrane-permeable/impermeable reagents

  • Fusion reporter assays: PhoA (periplasmic) or GFP (cytoplasmic) fusions at various positions

  • Glycosylation mapping: Introduce glycosylation sites and assess modification

  • SCAM (Substituted Cysteine Accessibility Method): Determine accessibility of engineered cysteines

  • EPR spectroscopy: Site-directed spin labeling to determine exposure to lipid/water

Results should be compared with topology predictions from computational tools and validated across multiple experimental approaches. The integration of experimental data with structural predictions has become increasingly important with the advancement of tools like AlphaFold .

What advanced biophysical methods can reveal functional dynamics of KPN78578_26420 in membranes?

Several biophysical techniques can provide insights into KPN78578_26420 dynamics:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Maps regions of conformational flexibility

  • Single-molecule FRET: Monitors distance changes between labeled residues

  • Solid-state NMR: Provides atomic-level dynamics in native-like membranes

  • Atomic force microscopy (AFM): Visualizes topography and mechanical properties

  • Fluorescence recovery after photobleaching (FRAP): Measures lateral diffusion in membranes

These techniques can be particularly informative when coupled with functional assays to correlate structural dynamics with specific functions. The combination of experimental biophysics with computational approaches has proven highly effective for membrane protein research .

How can structure-guided design be applied to modify KPN78578_26420 for improved stability or novel functions?

Structure-guided design of KPN78578_26420 can be approached through:

  • Computational alanine scanning: Identify residues critical for stability

  • Disulfide engineering: Introduce disulfide bonds to stabilize specific conformations

  • Interface redesign: Modify oligomerization properties

  • Ligand binding pocket modification: Engineer specificity for new ligands

  • Chimeric protein design: Fusion with functional domains from other proteins

Recent advances in membrane protein design have demonstrated the potential for introducing new functionalities using computational approaches . For KPN78578_26420, design strategies should consider the membrane environment and lipid interactions.

What considerations are important when designing KPN78578_26420 variants for epitope mapping and vaccine development?

When engineering KPN78578_26420 for immunological studies:

  • Epitope preservation: Ensure modifications don't disrupt native epitopes

  • Surface exposure: Focus on regions accessible to antibodies

  • Structural stability: Maintain proper folding in immunization-compatible formulations

  • Cross-reactivity evaluation: Test against diverse K. pneumoniae strains

  • Adjuvant compatibility: Design constructs compatible with vaccine adjuvants

Studies on other K. pneumoniae outer membrane proteins have shown that they can elicit protective immune responses and serve as vaccine candidates . Similar approaches could be applied to assess KPN78578_26420's potential in vaccine development, particularly examining the involvement of different immune responses (Th1, Th2, and Th17) .

How does KPN78578_26420 compare to other characterized UPF0208 family proteins across bacterial species?

Comparative analysis of KPN78578_26420 with other UPF0208 family proteins should include:

  • Sequence alignment: Identify conserved residues across species

  • Structural comparison: Superimposition of predicted or experimental structures

  • Genetic context analysis: Examine neighboring genes for functional clues

  • Expression pattern comparison: Determine if expression is similar across species

  • Phenotypic analysis: Compare deletion mutants from multiple species

This comparative approach can provide insights into evolutionary conservation and potential functional significance. Proteins with unknown function like KPN78578_26420 can often be better understood through such comparative genomics approaches.

What methodologies can detect potential horizontal gene transfer events involving KPN78578_26420?

To investigate horizontal gene transfer:

  • Phylogenetic incongruence analysis: Compare KPN78578_26420 tree to species tree

  • Codon usage analysis: Identify atypical codon usage patterns

  • GC content examination: Look for deviations from genome average

  • Flanking region analysis: Identify mobile genetic elements or integration sites

  • Comparative genomics: Examine presence/absence patterns across related species

Understanding the evolutionary history of KPN78578_26420 may provide insights into its function and importance in K. pneumoniae biology and pathogenesis.

How can KPN78578_26420 be evaluated as a potential vaccine antigen against K. pneumoniae infections?

Evaluation of KPN78578_26420 as a vaccine antigen should follow these steps:

  • Conservation analysis: Assess sequence conservation across clinical isolates

  • Antigenicity prediction: Use computational tools to identify potential B-cell epitopes

  • Recombinant expression optimization: Produce protein in suitable form for immunization

  • Antibody response characterization: Measure specific IgG, IgG1, and IgG2a levels

  • T-cell response analysis: Assess IFN-γ, IL-4, and IL-17A responses

  • Challenge studies: Test protection in appropriate animal models

  • Adjuvant optimization: Test different adjuvant formulations

Similar approaches have been successful for other K. pneumoniae outer membrane proteins, where specific immune responses (Th1, Th2, and Th17) were found to be protective in infection models . The recent development of DNA vaccines encoding outer membrane proteins, particularly when co-administered with immune modulators like IL-17, has shown promise against K. pneumoniae infections .

What experimental approaches can determine if KPN78578_26420 plays a role in antibiotic resistance mechanisms?

To investigate potential roles in antibiotic resistance:

  • Gene deletion and MIC testing: Compare minimum inhibitory concentrations between wild-type and mutant strains

  • Overexpression studies: Assess if increased expression affects resistance profiles

  • Antibiotic accumulation assays: Measure intracellular antibiotic concentrations

  • Membrane permeability assays: Test if deletion affects envelope integrity

  • Transcriptional response analysis: Examine expression changes upon antibiotic exposure

  • Interaction studies with known resistance proteins: Assess potential physical associations

These approaches can reveal if KPN78578_26420 directly contributes to intrinsic resistance or is involved in adaptive responses to antibiotic stress.

What are common pitfalls in recombinant expression of KPN78578_26420 and how can they be addressed?

Researchers may encounter several challenges when working with KPN78578_26420:

ChallengeManifestationSolution
Inclusion body formationInsoluble protein aggregatesLower expression temperature, use solubility tags, optimize detergents
Poor yieldLow protein levelsTest different promoters, optimize codon usage, use specialized host strains
Improper foldingLoss of function, aggregationCo-express with chaperones, use mild solubilization conditions
Proteolytic degradationMultiple bands on gelsAdd protease inhibitors, use protease-deficient strains
Tag interferenceAltered functionTest different tag positions or tag-free purification

Membrane proteins often require specialized approaches for expression and purification. For KPN78578_26420, E. coli-based expression systems have been documented , but optimization may be necessary for specific research applications.

How should contradictory results between computational predictions and experimental data for KPN78578_26420 be reconciled?

When facing conflicts between predictions and experiments:

  • Review quality metrics: Assess confidence scores of computational predictions

  • Examine experimental limitations: Consider potential artifacts or limitations

  • Perform validation experiments: Design tests specifically to address discrepancies

  • Consider environmental factors: Assess if membrane composition affects results

  • Employ orthogonal methods: Use additional techniques to resolve contradictions

  • Evaluate dynamic vs. static views: Consider if differences reflect conformational flexibility

The integration of computational and experimental approaches has been particularly valuable for membrane proteins, as highlighted by recent advances in protein structure prediction and design .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.