Recombinant Klebsiella pneumoniae subsp. pneumoniae UPF0259 membrane protein KPN78578_12180 (KPN78578_12180)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant KPN78578_12180 is expressed in Escherichia coli, leveraging its well-established system for high-yield protein synthesis . Critical production parameters include:

ParameterSpecification
Expression SystemE. coli
FormLyophilized powder
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS-based buffer, 50% glycerol, pH 8.0
Reconstitution0.1–1.0 mg/mL in deionized sterile water; glycerol (5–50%) for stability

Repeated freeze-thaw cycles are discouraged to prevent aggregation, a common challenge for hydrophobic membrane proteins .

Functional and Clinical Relevance

While the exact biological role of KPN78578_12180 remains under investigation, its classification as a membrane protein suggests potential involvement in:

  • Membrane integrity: Stabilizing bacterial cell membranes .

  • Antimicrobial resistance: Membrane proteins in Klebsiella pneumoniae often mediate efflux pump activity or porin regulation .

  • Pathogenicity: Membrane proteins are critical for host-pathogen interactions, including adhesion and immune evasion .

Studies on related UPF0259 family proteins (e.g., KPN78578_23020) highlight their conservation across Klebsiella strains, hinting at essential roles in bacterial survival .

4.1. Vaccine Development

Membrane proteins like KPN78578_12180 are promising candidates for serotype-independent vaccines due to their surface exposure and antigenic potential . For example:

  • Antigenicity: Recombinant outer membrane proteins (OMPs) of Klebsiella pneumoniae have elicited protective IgG responses in murine models .

  • Structural Studies: Cryo-EM and X-ray crystallography of solubilized membrane proteins (e.g., using WRAPs technology) could enable high-resolution structural analysis .

4.2. Biochemical Assays

KPN78578_12180 is used in ELISA-based studies to quantify immune responses or screen monoclonal antibodies .

Challenges and Future Directions

  1. Solubility Issues: Membrane proteins often require detergents or engineered solubilization systems (e.g., WRAPs) for functional studies .

  2. Functional Annotation: Computational modeling and mutagenesis are needed to map its precise role in bacterial physiology .

  3. Therapeutic Potential: Adjuvant optimization and formulation studies are critical for vaccine applications .

Comparative Analysis with Related Proteins

ProteinKPN78578_12180 KPN78578_23020
UniProt IDA6T7V8A6TAZ2
Length (aa)247188
Expression HostE. coliE. coli
TagHis tagHis tag
Storage-20°C/-80°C-20°C/-80°C

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
KPN78578_12180; KPN_01246; UPF0259 membrane protein KPN78578_12180
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Target Names
KPN78578_12180
Target Protein Sequence
MSITAKSVYRDTGNFFRNQFITILLIALLCAFITVVLGHAFSPSDEQLSILSEGDNLAGS AGLFELVQNMTPEQQQVLLRASAASTFSGLVGNAILVGGVLLLIQLVSAGHRVSALRAIG ASAPVLPKLLLLILFTTFLVQMGMMLVLVPGVLLAIVLAFAPIMLVQDNMGILGAMRSSM RLAWANLRLVAPAIIGWLVAKTLLLLFASSFAALTPNVGAVVINTISNLISALLLIYLFR VYMLIRS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are recommended for recombinant production of KPN78578_12180?

  • Expression vectors: Use vectors with tunable promoters (e.g., T7-based systems with IPTG induction) to prevent toxic overexpression

  • Fusion partners: Consider fusion tags that can enhance solubility and facilitate purification:

    • N-terminal MBP (maltose-binding protein)

    • C-terminal His-tag (should be positioned to avoid interfering with membrane insertion)

For more challenging cases, alternative expression systems may be required:

  • Cell-free expression systems

  • Yeast expression systems (P. pastoris)

  • Mammalian cell lines for complex membrane proteins

Expression conditions should be optimized through small-scale expression trials monitoring multiple variables (temperature, induction time, inducer concentration) .

How should KPN78578_12180 be stored to maintain structural integrity?

Based on recombinant protein handling guidelines, KPN78578_12180 should be stored in Tris-based buffer with 50% glycerol at -20°C for routine storage, or at -80°C for long-term storage. Repeated freezing and thawing should be avoided. For working stocks, store aliquots at 4°C for up to one week to minimize degradation .

The choice of detergent is critical for membrane protein stability. Common detergents used for membrane protein storage include:

DetergentCMC (mM)PropertiesRecommended Concentration
DDM0.17Mild, maintains activity0.03-0.05%
LMNG0.01Enhanced stability0.01-0.02%
DigitoninVariableNative-like environment0.1-0.5%

What is the most reliable method to determine the orientation of KPN78578_12180 in reconstituted membranes?

The orientation of KPN78578_12180 in reconstituted membranes is crucial for functional studies. A highly effective approach is cysteine-specific chemical modification using:

  • A cyanine fluorophore that labels accessible cysteine residues

  • A membrane-impermeable fluorescence quencher

This method allows rapid evaluation of protein orientation distribution after reconstitution. The assay has been validated with respiratory complexes like bo3 oxidase and ATP synthase from E. coli, with results consistent with other orientation determination approaches .

The procedure involves:

  • Labeling the protein with a cysteine-reactive fluorophore

  • Reconstituting the labeled protein into liposomes

  • Adding a membrane-impermeable quencher

  • Measuring fluorescence quenching to determine the fraction of protein with cysteines facing the external environment

This approach is particularly valuable for optimization of reconstitution conditions prior to functional measurements .

What are the optimal methods for reconstituting KPN78578_12180 into a native-like membrane environment?

Lipid nanodiscs represent an excellent system for reconstituting membrane proteins like KPN78578_12180 into a native-like environment for structural and functional studies. These systems consist of a patch of lipid bilayer encircled by membrane scaffold proteins (MSPs) .

Recommended reconstitution protocol:

  • Preparation of components:

    • Purify KPN78578_12180 in a mild detergent (e.g., DDM)

    • Prepare MSP proteins (MSP1D1 for ~10 nm nanodiscs)

    • Prepare lipid mixture (consider E. coli total lipid extract or defined mixtures)

  • Assembly process:

    • Mix protein:MSP:lipid at optimized ratios (typically 1:2:120-160)

    • Incubate mixture at 4°C

    • Remove detergent using Bio-Beads or dialysis

    • Purify assembled nanodiscs by size exclusion chromatography

  • Quality control:

    • Verify nanodisc size homogeneity (6-26 nm diameter, depending on MSP variant)

    • Confirm protein incorporation using a robust assay to determine the number of protein molecules per nanodisc

For enhanced stability and homogeneity, consider using circularized MSPs produced through protein ligation methods .

How can I resolve contradictory results in membrane protein orientation studies with KPN78578_12180?

When faced with contradictory results regarding KPN78578_12180 orientation, consider these methodological approaches:

  • Apply multiple independent techniques:

    • Cysteine-accessibility assays (fluorescence-based)

    • Antibody-based detection of epitope tags

    • Proteolysis patterns with orientation-selective proteases

    • Functional assays if the protein has known directional activity

  • Control for reconstitution variables:

    • Lipid composition significantly affects protein orientation

    • Detergent-to-lipid ratios during reconstitution

    • pH and ionic strength of reconstitution buffer

    • Protein concentration during reconstitution

  • Systematic experimental design:

    • Implement factorial experimental designs to identify interactive variables

    • Use time-series experimental designs to capture dynamics of protein insertion

    • Apply equivalent materials design to test consistency across protein preparations

  • Statistical analysis:

    • Use appropriate statistical tests to determine significance of differences

    • Consider multiple time-series designs to eliminate temporal confounds

What NMR techniques are most appropriate for studying the structure of KPN78578_12180?

For structural studies of membrane proteins like KPN78578_12180, several NMR approaches can be employed depending on the specific research questions:

  • Solution-state NMR with nanodiscs:

    • Requires isotopically labeled protein (15N, 13C, 2H)

    • Best suited for smaller membrane proteins or domains

    • TROSY-based pulse sequences to overcome size limitations

    • Can provide high-resolution structural information in a native-like lipid environment

  • Solid-state NMR:

    • Appropriate for larger membrane proteins

    • Can be performed on proteins reconstituted in lipid bilayers

    • Magic-angle spinning (MAS) techniques reduce line broadening

    • Provides information on protein-lipid interactions

  • Paramagnetic relaxation enhancement (PRE):

    • Attachment of paramagnetic tags at specific positions

    • Provides long-range distance constraints

    • Useful for determining topology and orientation

The size of nanodiscs can be optimized (from 6 to 26 nm in diameter) to accommodate KPN78578_12180 and provide optimal conditions for NMR measurements .

How does the membrane lipid environment affect the structure and function of KPN78578_12180?

The membrane lipid environment plays a crucial role in determining the structure, dynamics, and function of membrane proteins like KPN78578_12180. Key considerations include:

  • Lipid bilayer thickness:

    • Hydrophobic mismatch between protein transmembrane domains and bilayer thickness can cause protein deformation or aggregation

    • Adjust lipid composition to match the hydrophobic thickness of KPN78578_12180

  • Membrane fluidity and order:

    • Sterols (like cholesterol) increase membrane order and thickness

    • Highly ordered membrane regions can affect protein dynamics and conformation

    • Use environment-sensitive probes like di-4-ANEPPDHQ to visualize membrane order in domains containing the protein

  • Specific lipid interactions:

    • Phosphoinositides (particularly PI4P) can recruit proteins to specific membrane locations

    • PI4P creates a negatively charged electrostatic field at the inner leaflet of the plasma membrane

    • Experimental manipulation of PI4P levels (using tools like MAP-mTU2-SAC1p) can test PI4P dependence

  • Lateral organization:

    • Membrane proteins may segregate into nanodomains

    • Sterol-dependent segregation can be disrupted by compounds like fenpropimorph that alter sterol composition

When studying KPN78578_12180, systematically varying these parameters can provide insights into how the lipid environment modulates protein structure and function.

What experimental approaches can determine if KPN78578_12180 forms oligomeric structures?

To determine if KPN78578_12180 forms oligomeric structures, employ multiple complementary techniques:

  • Biochemical approaches:

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Chemical crosslinking followed by SDS-PAGE or mass spectrometry

    • Blue native PAGE to preserve native oligomeric states

  • Biophysical methods:

    • Analytical ultracentrifugation to determine sedimentation coefficients

    • FRET between differentially labeled protein variants

    • Single-molecule fluorescence to detect co-localization or co-diffusion

  • Structural approaches:

    • Negative-stain electron microscopy to visualize oligomeric assemblies

    • Cryo-EM for high-resolution structural determination of complexes

    • NMR studies in nanodiscs can detect intermolecular contacts

  • Functional studies:

    • Dominant negative mutants that disrupt function only in oligomeric states

    • Complementation assays with differently tagged variants

What approaches can determine the physiological role of KPN78578_12180 in Klebsiella pneumoniae?

To elucidate the physiological role of KPN78578_12180 in Klebsiella pneumoniae, implement a multi-faceted approach:

  • Genetic manipulation:

    • Gene knockout using CRISPR-Cas9 or homologous recombination

    • Conditional expression systems to control protein levels

    • Site-directed mutagenesis of conserved residues

    • Complementation studies to verify phenotypes

  • Phenotypic characterization:

    • Growth curves under various conditions (temperature, pH, osmolarity)

    • Resistance profiles against antibiotics and environmental stressors

    • Membrane integrity assays (fluorescent dye uptake)

    • Biofilm formation capacity

  • Localization studies:

    • Fluorescent protein fusions to determine subcellular localization

    • Immunogold electron microscopy for high-resolution localization

    • Analysis of protein dynamics using single-particle tracking

  • Interactome analysis:

    • Co-immunoprecipitation followed by mass spectrometry

    • Bacterial two-hybrid screening

    • Proximity labeling techniques (BioID, APEX)

What methods can identify potential binding partners or substrates of KPN78578_12180?

To identify potential binding partners or substrates of KPN78578_12180, consider these methodological approaches:

  • Affinity-based methods:

    • Pull-down assays using tagged KPN78578_12180 as bait

    • Co-immunoprecipitation with antibodies against the protein

    • Chemical crosslinking coupled with mass spectrometry (XL-MS)

    • Surface plasmon resonance (SPR) with purified candidates

  • Proximity-based methods:

    • BioID or TurboID fusion proteins that biotinylate nearby proteins

    • APEX2 fusion for proximity-dependent labeling

    • Split-protein complementation assays (e.g., split-GFP)

  • Biophysical interaction studies:

    • Microscale thermophoresis to measure binding affinities

    • Isothermal titration calorimetry for thermodynamic parameters

    • Fluorescence correlation spectroscopy for molecular interactions

    • NMR chemical shift perturbation assays

  • Functional screens:

    • Suppressor mutant screens to identify genetic interactions

    • Transposon insertion libraries to identify synthetic lethal interactions

    • High-throughput substrate screening if enzymatic activity is suspected

For membrane proteins like KPN78578_12180, it's crucial to maintain the protein in an appropriate membrane-mimetic environment during these studies, such as nanodiscs or amphipols.

How can single-molecule approaches enhance our understanding of KPN78578_12180 dynamics?

Single-molecule approaches provide unique insights into membrane protein dynamics that are obscured in ensemble measurements:

  • Single-particle tracking (SPT):

    • Label KPN78578_12180 with photostable fluorophores or quantum dots

    • Track individual molecules with high spatial (10-20 nm) and temporal resolution

    • Analyze diffusion coefficients, confinement, and transition probabilities

    • Construct mobility maps to identify membrane compartmentalization

  • Significance of mobility parameters:

    • Different diffusion modes (Brownian, confined, directed) suggest different functional states

    • Mobility is not necessarily coupled to supramolecular organization

    • Changes in diffusion upon treatments can reveal regulatory mechanisms

  • Super-resolution microscopy techniques:

    • PALM/STORM imaging to resolve nanodomain organization below the diffraction limit

    • Single-molecule localization microscopy to map protein distribution with 20-30 nm precision

    • Correlate protein organization with membrane order using environment-sensitive probes

  • Functional relevance:

    • Mutations affecting single-molecule mobility may also impair biological function

    • The relationship between nanodomain organization and biological function can be tested using mutants with altered mobility patterns

How can contradictions in structural data for KPN78578_12180 be reconciled across different experimental platforms?

When faced with contradictory structural data for KPN78578_12180 from different experimental approaches, consider these strategies:

  • Systematic comparison of experimental conditions:

    • Lipid composition differences between studies

    • Detergent effects on protein conformation

    • pH, temperature, and buffer conditions

    • Presence of stabilizing ligands or binding partners

  • Integrative structural biology approach:

    • Combine low and high-resolution techniques

    • Use computational methods to integrate diverse experimental constraints

    • Develop ensemble models that represent conformational heterogeneity

    • Validate models with orthogonal experimental approaches

  • Consider native membrane context:

    • Proteins may adopt different conformations in detergent micelles versus lipid bilayers

    • Nanodiscs provide a more native-like environment than detergent micelles

    • Local membrane properties can influence protein structure and dynamics

  • Experimental design considerations:

    • Implement multiple time-series designs to capture dynamic structural changes

    • Use equivalent materials design to ensure consistency across experimental platforms

    • Consider quasi-experimental designs when full experimental control is not possible

What computational approaches complement experimental studies of KPN78578_12180?

Computational approaches provide valuable complements to experimental studies of membrane proteins like KPN78578_12180:

  • Structural prediction and modeling:

    • Ab initio structure prediction using methods like AlphaFold2

    • Homology modeling based on related UPF0259 family proteins

    • Molecular dynamics simulations to study conformational dynamics

    • Coarse-grained simulations for longer timescale events

  • Molecular dynamics in membrane environments:

    • All-atom simulations in explicit lipid bilayers

    • Analysis of protein-lipid interactions

    • Investigation of conformational changes in response to membrane properties

    • Free energy calculations for substrate binding or conformational transitions

  • Functional prediction:

    • Ligand docking to identify potential binding partners

    • Electrostatic surface analysis to identify interaction interfaces

    • Conservation analysis to identify functionally important residues

    • Network analysis of predicted protein-protein interactions

  • Integration with experimental data:

    • Refinement of structures against experimental constraints

    • Prediction of spectroscopic observables for validation

    • Simulation of mutation effects that can be tested experimentally

How can quasi-experimental designs address challenges in studying KPN78578_12180 in native bacterial membranes?

Studying membrane proteins like KPN78578_12180 in their native bacterial membranes presents unique challenges that can be addressed through quasi-experimental designs:

  • Time-series experimental designs:

    • Monitor protein expression, localization, and function over time

    • Establish baseline measurements before experimental interventions

    • Apply statistical tests specifically designed for time-series data

    • Control for maturation effects and instrumental drift

  • Equivalent time-samples design:

    • When continuous measurement is not possible, take equivalent samples at different timepoints

    • Rotate measurement schedules to control for time-of-day effects

    • Apply appropriate statistical tests for this design

  • Nonequivalent control group designs:

    • When random assignment is not possible (e.g., different bacterial strains)

    • Include pretests to establish baseline differences

    • Use statistical methods to account for pre-existing differences

    • Implement matched samples based on relevant variables

  • Multiple time-series design:

    • Compare experimental and control groups across multiple time points

    • Particularly valuable for membrane protein studies where expression levels may vary

    • Provides robust evidence for causal relationships even without randomization

These quasi-experimental approaches can provide rigorous evidence when traditional experimental control is limited, as is often the case when studying membrane proteins in their native environment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.