Recombinant Klebsiella pneumoniae subsp. pneumoniae UPF0283 membrane protein KPN78578_12740 (KPN78578_12740)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
KPN78578_12740; KPN_01302; UPF0283 membrane protein KPN78578_12740
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Target Names
KPN78578_12740
Target Protein Sequence
MSEPLKPRIDFDGPLQAEKIPPLKGARAFDTLEADNFAPARLVTGEEEEGAAEAVVESVL RPKRSLWRRMVSAGLAIFGVSVVAQGVQWTANAWQTQDWIALGGCVAGALIVGAGVGSLA TEWRRLWRLRQRAHERDEARDMLHSHAVGKAKAFCEKLAQQAGLDQSHPALQRWYAAIHE TQSDREVVSLYAQLVQPVLDAQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFRLVLLNIAFAGASELVREVGMDWMSQDLAARLSARAAQGIG AGLLTARLGIKAMELCRPLPWIADDKPRLGDFRRELIGQLKETLQKSKTRPEK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • What approaches are recommended for determining the membrane topology of KPN78578_12740?

Membrane topology determination requires multiple complementary experimental approaches:

Experimental Strategy for Topology Mapping:

  • Cysteine Scanning Mutagenesis with PEGylation

    • Generate a cysteine-less variant of KPN78578_12740

    • Introduce individual cysteines at predicted loop regions

    • Treat intact cells or spheroplasts with membrane-impermeable sulfhydryl reagents

    • Analyze accessibility patterns to determine cytoplasmic vs. periplasmic exposure

  • Fusion Reporter Approach

    • Create fusion constructs with reporter proteins (GFP, PhoA, LacZ)

    • Generate truncations at different points along the protein sequence

    • Measure reporter activity to determine cellular localization

    • High PhoA activity indicates periplasmic location; high GFP fluorescence suggests cytoplasmic orientation

  • Protease Protection Assays

    • Express protein in membrane vesicles with defined orientation

    • Treat with proteases (trypsin, proteinase K)

    • Analyze digestion patterns by Western blotting with domain-specific antibodies

    • Protected regions indicate membrane-embedded or opposite-side domains

These data should be integrated with computational predictions from tools like TMHMM, TOPCONS, and MEMSAT to generate a comprehensive topology model.

  • What methodologies are recommended for studying potential protein-protein interactions of KPN78578_12740?

As a membrane protein, KPN78578_12740 requires specialized approaches for interaction studies:

Recommended Methods:

  • Membrane-Based Yeast Two-Hybrid (MYTH)

    • Split-ubiquitin based system specifically designed for membrane proteins

    • KPN78578_12740 is fused to C-terminal half of ubiquitin and transcription factor

    • Prey proteins fused to N-terminal half of ubiquitin

    • Interaction reconstitutes ubiquitin, leading to transcription factor release and reporter gene activation

    • Particularly suitable for identifying interactions with other membrane or membrane-associated proteins

  • Cross-Linking Mass Spectrometry (XL-MS)

    • Treat purified KPN78578_12740 in native membranes or reconstituted systems with crosslinkers

    • Digest crosslinked proteins and analyze by LC-MS/MS

    • Identify crosslinked peptides using specialized software (pLink, StavroX)

    • Provides spatial relationship data between interacting proteins

  • Co-Immunoprecipitation with Stabilized Detergent Micelles

    • Solubilize membranes under gentle conditions (digitonin or styrene maleic acid lipid particles)

    • Perform pull-down with anti-His antibodies or specific antibodies against KPN78578_12740

    • Identify co-precipitating proteins by mass spectrometry

    • Validate interactions through reciprocal co-IP experiments

  • Microscale Thermophoresis (MST) or Bio-Layer Interferometry (BLI)

    • For investigating direct interactions with purified candidate partners

    • Maintain KPN78578_12740 in suitable detergent micelles or nanodiscs

    • Measure binding affinities and kinetics in solution

These approaches should be combined to build a comprehensive interactome, with particular attention to maintaining the native membrane environment whenever possible.

  • How can researchers design experiments to study the role of KPN78578_12740 in K. pneumoniae virulence or antimicrobial resistance?

Investigating the potential role of KPN78578_12740 in virulence or antimicrobial resistance requires multiple experimental approaches:

Genetic Manipulation Strategies:

  • Gene Knockout and Complementation

    • Create ΔkpnOmp deletion mutant using allelic exchange or CRISPR-Cas9

    • Complement with wild-type and mutant alleles

    • Compare phenotypes across strains for:

      • Growth kinetics in various media

      • Biofilm formation

      • Antibiotic susceptibility profiles (MIC determination)

      • Stress tolerance (oxidative stress, pH, osmotic pressure)

  • Virulence Assessment

    • In vitro models:

      • Adhesion and invasion assays using relevant cell lines (A549, HEp-2, macrophages)

      • Serum resistance assays

      • Antimicrobial peptide resistance

    • In vivo models:

      • Murine pneumonia or urinary tract infection models

      • Galleria mellonella infection model for preliminary screening

      • Competitive index assays comparing wild-type and mutant strains

  • Transcriptomic/Proteomic Profiling

    • RNA-Seq or proteomics comparing wild-type and knockout strains

    • Identify dysregulated pathways that might explain phenotypic changes

    • Validate key findings with qRT-PCR or targeted proteomics

This systematic approach would provide insights into whether KPN78578_12740 plays a role in bacterial fitness, virulence, or antimicrobial resistance, similar to studies conducted with other outer membrane proteins of K. pneumoniae .

  • What approaches should be used to assess the immunogenicity and vaccine potential of KPN78578_12740?

Based on successful immunogenicity studies of other K. pneumoniae outer membrane proteins, researchers should follow this experimental framework:

Immunogenicity Assessment Protocol:

This approach mirrors successful studies with K. pneumoniae outer membrane proteins that demonstrated protective efficacy, particularly those that induced balanced Th1, Th2, and Th17 responses, as seen with Kpn_Omp001, Kpn_Omp002, and Kpn_Omp005 .

  • What bioinformatic approaches are most valuable for predicting functional domains and potential binding partners of KPN78578_12740?

A multi-layered bioinformatic strategy is essential for generating functional hypotheses:

Recommended Bioinformatic Pipeline:

  • Sequence-Based Analysis

    • Multiple sequence alignment across diverse bacterial species

    • Conservation analysis to identify critical residues

    • Motif scanning using PROSITE, ELM, and MEME

    • Disorder prediction to identify flexible regions (DISOPRED, IUPred)

  • Structural Prediction and Analysis

    • Ab initio structure prediction using AlphaFold2 or RoseTTAFold

    • Template-based modeling if homologous structures exist

    • Molecular dynamics simulations to identify stable conformations

    • Electrostatic surface mapping to identify potential interaction sites

    • Ligand binding site prediction (COACH, COFACTOR)

  • Genomic Context Analysis

    • Examine gene neighborhood conservation across bacterial species

    • Analyze co-expression patterns from transcriptomic datasets

    • Identify synteny and operonic structure

  • Protein-Protein Interaction Prediction

    • STRING database analysis of predicted functional partners

    • Interolog mapping from related bacterial species

    • Surface complementarity analysis from predicted structures

  • Integration with Experimental Data

    • Map proteomic data to identify post-translational modifications

    • Correlate with transcriptomic data to identify co-regulated genes

    • Cross-reference with phenotypic data from related gene knockouts

This comprehensive computational approach can generate testable hypotheses about protein function that guide subsequent experimental design.

  • What are the optimal conditions for designing site-directed mutagenesis experiments to study structure-function relationships in KPN78578_12740?

A systematic mutagenesis approach should target key structural and functional elements:

Mutagenesis Strategy:

  • Rational Selection of Target Residues

    Residue TypeSelection CriteriaPurpose
    Conserved residuesIdentified through multiple sequence alignmentLikely functional importance
    Charged residues (D, E, K, R)Located in predicted transmembrane regionsPotential ion transport or binding
    Aromatic residues (W, Y, F)Located at membrane interfacesMembrane anchoring and stability
    Glycine/ProlineWithin predicted helical regionsConformational flexibility
    CysteineEvaluate potential disulfide formationStructural stability
  • Types of Mutations to Consider

    • Conservative substitutions (e.g., D→E, K→R) to test chemical property requirements

    • Non-conservative substitutions to drastically alter properties

    • Alanine scanning to remove side chain contributions

    • Introduction of charged residues in hydrophobic regions to disrupt membrane insertion

  • Experimental Validation of Mutants

    • Expression and membrane localization verification

    • Structural integrity assessment (CD spectroscopy, thermal stability)

    • Functional assays based on predicted activities

    • In vivo phenotypic analysis in K. pneumoniae if gene replacement is possible

This methodical approach to mutagenesis can reveal critical residues involved in protein folding, membrane insertion, and potential functional activities, providing insights into structure-function relationships of this uncharacterized protein.

  • How can researchers develop assays to determine the specific biological function of KPN78578_12740?

Given the limited functional information about KPN78578_12740, a hypothesis-driven screening approach is recommended:

Functional Characterization Strategy:

  • Transporter Activity Screening

    • Reconstitute purified protein into liposomes loaded with fluorescent indicators

    • Test transport of various substrates:

      • Ions (proton, sodium, potassium) using pH-sensitive or ion-specific fluorophores

      • Antibiotics using fluorescently labeled compounds

      • Nutrients using radiolabeled or fluorescent analogs

    • Compare transport rates between proteoliposomes and control liposomes

  • Binding Assays

    • Develop thermal shift assays with potential ligands

    • Surface plasmon resonance with immobilized protein

    • Isothermal titration calorimetry for thermodynamic binding parameters

  • Protein-Protein Interaction Mapping

    • Pull-down assays with lysates from different growth conditions

    • Bacterial two-hybrid screening with genomic library

    • In vivo crosslinking followed by mass spectrometry

  • Phenotypic Characterization

    • Compare growth of wild-type and knockout strains under various stresses:

      • Osmotic stress (high salt, sucrose)

      • pH stress (acidic and alkaline conditions)

      • Antibiotic exposure (multiple classes)

      • Membrane-disrupting agents (detergents, antimicrobial peptides)

    • Examine changes in membrane permeability and potential

  • Comparative Transcriptomics/Proteomics

    • RNA-Seq and proteomics comparing wild-type and knockout strains

    • Identify pathways affected by protein absence

    • Use pathway enrichment analysis to generate functional hypotheses

This comprehensive functional screening approach can help elucidate the biological role of this uncharacterized membrane protein.

  • What challenges might researchers encounter when attempting to crystallize KPN78578_12740 for structural studies?

Membrane protein crystallization presents unique challenges requiring specialized approaches:

Common Challenges and Solutions:

  • Protein Stability Issues

    • Challenge: Detergent-solubilized membrane proteins often exhibit limited stability

    • Solutions:

      • Screen multiple detergents (DDM, LMNG, LDAO, etc.)

      • Add lipids to stabilize native-like environment (E. coli lipids, cholesterol)

      • Use thermal stability assays to identify optimal conditions

      • Consider protein engineering to remove flexible regions

  • Crystallization Barriers

    • Challenge: Limited polar surface area for crystal contacts

    • Solutions:

      • Fusion with crystallization chaperones (T4 lysozyme, BRIL, antibody fragments)

      • In meso crystallization methods (lipidic cubic phase)

      • Antibody-fragment co-crystallization approaches

      • Crystal engineering through surface entropy reduction

  • Alternative Structural Approaches

    • Cryo-electron microscopy (particularly suitable if KPN78578_12740 forms oligomers)

    • NMR spectroscopy for specific domains or in detergent micelles

    • Hydrogen-deuterium exchange mass spectrometry for dynamics and accessibility

Crystallization MethodAdvantagesConsiderations
Vapor diffusionTraditional, widely accessibleOften less successful for membrane proteins
Lipidic cubic phaseMimics native environmentRequires specialized equipment and expertise
Bicelle methodIntermediate between detergent and lipid bilayerTemperature-sensitive setup
Nanodisc/SaliproMaintains native lipid environmentMay limit crystal contacts

Successful structural studies will likely require iterative optimization and flexibility in methodological approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.