Recombinant Klebsiella pneumoniae subsp. pneumoniae UPF0442 protein KPN78578_47350 (KPN78578_47350)

What is the basic structure of KPN78578_47350 protein?

KPN78578_47350 is a full-length (157 amino acid) protein belonging to the UPF0442 family from Klebsiella pneumoniae subsp. pneumoniae. The amino acid sequence is: MGIISFIFALAEDMLLAAIPAVGFAMVFNVPQRALRWCALLGAIGHGSRMIMMSAGFNIE WATFLAALLVGSIGIQWSRWYLAHPKIFTVAAVIPMFPGISAYTAMISAVKISHFGYSEE MMILLLSNFLKASSIVGALSIGLSIPGLWLYRKRPRV . The protein contains multiple hydrophobic regions, suggesting it may be a membrane-associated protein. Structural predictions would require computational modeling as the tertiary structure has not been explicitly defined in the available literature.

Which protein family does KPN78578_47350 belong to and what are its known synonyms?

KPN78578_47350 belongs to the UPF0442 protein family. The known synonyms include KPN_04813 and "UPF0442 protein KPN78578_47350" . The UniProt identifier for this protein is A6THX5 . The UPF (Uncharacterized Protein Family) designation indicates that while the protein has been identified, its specific biological functions remain largely uncharacterized, presenting an opportunity for novel research.

What are the predicted cellular localizations for KPN78578_47350?

Based on its amino acid sequence, which contains multiple hydrophobic regions, KPN78578_47350 is likely membrane-associated. The research on K. pneumoniae-human protein interactions suggests that proteins involved in pathogen-host interactions are often secretory proteins localizing at the pathogen-host interface . Computational prediction tools would be required to confirm subcellular localization, but the presence of hydrophobic domains and potential membrane-spanning regions in its sequence suggests it could be associated with the bacterial membrane.

How should KPN78578_47350 recombinant protein be expressed and purified for laboratory studies?

The recombinant KPN78578_47350 protein can be expressed in E. coli with an N-terminal His-tag for purification purposes . The expression system should be optimized for bacterial proteins, using appropriate promoters and growth conditions. For purification:

• Use immobilized metal affinity chromatography (IMAC) leveraging the His-tag

• Consider additional purification steps such as size-exclusion chromatography

• Verify protein purity through SDS-PAGE (>90% purity should be expected)

• The resulting protein will be in lyophilized powder form and should be reconstituted according to specific protocols

What are the optimal storage conditions for maintaining KPN78578_47350 stability?

For optimal stability of KPN78578_47350:

• Store the lyophilized protein at -20°C/-80°C upon receipt

• Perform aliquoting when multiple uses are anticipated

• Avoid repeated freeze-thaw cycles which can compromise protein integrity

• For working solutions, maintain at 4°C for up to one week

• Use a storage buffer consisting of Tris/PBS-based buffer with 6% Trehalose at pH 8.0

• For long-term storage, reconstitute in deionized sterile water to 0.1-1.0 mg/mL and add 5-50% glycerol (recommended final concentration of glycerol is 50%)

What reconstitution protocols are recommended for experimental use of KPN78578_47350?

The recommended reconstitution protocol includes:

• Briefly centrifuge the vial prior to opening to bring contents to the bottom

• Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to 5-50% final concentration for long-term storage

• Aliquot the reconstituted protein to minimize freeze-thaw cycles

• Verify protein concentration after reconstitution using standard methods (Bradford/BCA assay)

What experimental approaches can be used to identify potential interaction partners of KPN78578_47350?

To identify potential interaction partners of KPN78578_47350, researchers can employ several approaches:

• Computational prediction methods: Utilizing homology-based approaches as described in the K. pneumoniae-human interactome studies . These methods analyze functional similarity between proteins to predict potential interactions.

• Yeast two-hybrid (Y2H) screening: Though challenging for bacterial proteins, this is a well-established method for detecting protein-protein interactions and has been used for pathogen-host PPI networks .

• Co-immunoprecipitation coupled with mass spectrometry: Expressing tagged KPN78578_47350 in relevant systems and pulling down interaction partners.

• Bacterial two-hybrid systems: Modified specifically for bacterial proteins to overcome limitations of traditional Y2H.

• Crosslinking methods: Chemical crosslinking followed by mass spectrometry to identify proximal proteins.

The selection of appropriate method depends on research objectives, with computational predictions providing initial hypotheses that can be validated experimentally.

What is the potential role of KPN78578_47350 in Klebsiella pneumoniae pathogenesis?

While the specific role of KPN78578_47350 in pathogenesis is not directly characterized in the provided literature, insights can be drawn from broader research on K. pneumoniae:

• As a bacterial protein, KPN78578_47350 may be involved in host-pathogen interactions. The computational studies of K. pneumoniae-human interactome suggest that bacterial proteins often target key host processes including immune signaling, proteasomal degradation, and mRNA processing .

• The protein's membrane-associated nature suggests potential roles in:

  • Bacterial adhesion to host cells

  • Transport of nutrients or virulence factors

  • Evasion of host immune responses

  • Maintenance of bacterial membrane integrity during infection

• Studies on K. pneumoniae show that fitness of pathogen proteins correlates with their tendency to interact with host proteins . Further experimental validation would be needed to confirm KPN78578_47350's specific contribution to virulence.

How does KPN78578_47350 compare to homologous proteins in other bacterial species?

Comparison of KPN78578_47350 with homologous proteins in other bacterial species can provide evolutionary insights:

• Functional similarity analysis: Research indicates that approximately 83% of K. pneumoniae proteins show functional similarity with corresponding homologs in other pathogen species (sharing at least one GO term) . This suggests functional conservation across bacterial species.

• Sequence conservation analysis: Using multiple sequence alignment tools to identify conserved domains within UPF0442 family proteins across different bacterial species.

• Structural comparisons: If structural data becomes available, comparing the folding patterns and active sites with homologs.

• Evolutionary rate analysis: Determining whether the protein is under purifying or positive selection, which might indicate functional importance.

This comparative approach can help elucidate the protein's broader role in bacterial physiology and pathogenesis.

How might KPN78578_47350 interact with human host proteins during infection?

Based on the K. pneumoniae-human interactome studies, bacterial proteins like KPN78578_47350 potentially interact with host proteins through several mechanisms:

• Direct binding to host targets: K. pneumoniae proteins have been found to preferentially target inter-complex protein-protein interactions in the host, disrupting functional coordination between protein complexes .

• Disruption of host signaling pathways: Host targets are often functionally enriched in immune surveillance systems and related functions like apoptosis and hypoxia response .

• Modulation of transcription factors: K. pneumoniae proteins may target pivotal host transcription factors that generate transcriptional responses during sepsis .

• Integration into host membranes: Given its hydrophobic nature, KPN78578_47350 might integrate into host cell membranes, potentially disrupting membrane integrity or function.

Experimental validation of these potential mechanisms would require techniques such as protein-protein interaction assays, fluorescence microscopy for localization studies, and functional assays measuring specific host responses.

What computational methods can predict KPN78578_47350's structural features and potential binding sites?

Advanced computational methods to predict structural features and binding sites include:

• Homology modeling: Using known protein structures as templates if sufficient sequence similarity exists with characterized proteins.

• Ab initio modeling: For novel proteins with limited homology to known structures.

• Molecular dynamics simulations: To understand protein flexibility and conformational changes.

• Binding site prediction algorithms: Tools like CASTp, POCASA, or FTSite can identify potential ligand-binding pockets.

• Protein-protein docking simulations: To predict interactions with potential host targets.

• Evolutionary coupling analysis: As mentioned in search result , plmDCA or evCouplings based on plmDCA can detect epistatic signals for contact prediction, enabling structural model construction.

• Sequence-space exploration models: These can simulate protein evolution in a data-driven sequence landscape, helping to understand structural constraints .

The quality of predictions depends on multiple factors, including sequence conservation, availability of homologous structures, and the depth of sequence information available.

How can experimental evolution approaches be applied to study KPN78578_47350 function?

Experimental evolution approaches can provide unique insights into KPN78578_47350 function:

• Directed evolution: Creating libraries of KPN78578_47350 variants through random mutagenesis and selecting for specific properties (e.g., enhanced binding to substrates, stability).

• Deep mutational scanning: Systematically mutating each residue and assessing functional consequences to identify critical regions.

• Ancestral sequence reconstruction: Inferring and synthesizing ancestral versions of the protein to understand evolutionary trajectories.

• Sequence-space exploration: As described in search result , this approach can track how proteins explore sequence space through random mutations and phenotypic selection, potentially revealing epistatic interactions.

• Experimental selection under varying conditions: Applying selection pressure that mimics host environments to identify adaptations that enhance pathogen fitness.

These approaches can generate diversified sequence libraries (typically 10-15% divergence from wild-type) with 10-40 mutations emerging simultaneously . The resulting data can be analyzed for epistatic signals that inform both function and structure.

What epistatic signals might emerge from sequence analysis of KPN78578_47350 variants?

Epistatic signals in KPN78578_47350 variants can provide valuable structural and functional insights:

• Contact prediction: Correlated mutations in protein sequences often indicate physical proximity in the folded structure. Tools like plmDCA can detect these signals if sufficient sequence diversity is available .

• Functional coupling: Some mutations may compensate for others, revealing functional relationships between distant residues.

• Fitness landscapes: Mapping how combinations of mutations affect protein fitness can reveal constraints on protein evolution.

• Sector identification: Groups of co-evolving residues often form functional sectors within proteins.

For these approaches to be successful with KPN78578_47350, experimental evolution would need to generate libraries with:

• Sufficient depth (10^4-10^5 sequences)

• Adequate divergence (10-15% from wild-type)

• Multiple simultaneous mutations (10-40 per sequence)

The success of structural prediction from epistatic signals varies considerably between experiments, possibly due to differences in library diversity and depth .

How can integration of genomic and proteomic data enhance our understanding of KPN78578_47350?

Integration of multiple data types provides a more comprehensive understanding of KPN78578_47350:

• Comparative genomics: Analyzing the conservation and synteny of the gene across Klebsiella strains and related species.

• Transcriptomic analysis: Identifying conditions that regulate KPN78578_47350 expression (e.g., during infection, under stress).

• Proteomics: Mass spectrometry to identify post-translational modifications or interaction partners.

• Structural biology: X-ray crystallography or cryo-EM studies, if feasible, to determine three-dimensional structure.

• Functional genomics: Phenotypic effects of gene knockout or overexpression.

• Systems biology models: Integrating the protein into broader pathway and network models of K. pneumoniae.

• Host response data: Connecting bacterial protein presence with host transcriptomic or proteomic changes during infection.

This multi-omics approach can place KPN78578_47350 in its biological context, potentially revealing functions not apparent from single-method studies.

What role might KPN78578_47350 play in bacterial fitness during infection?

The potential role of KPN78578_47350 in bacterial fitness during infection can be inferred from several aspects:

• Virulence contribution: Research on pathogen-host interactions suggests that fitness of a pathogen is determined by successful interaction with its host . Higher-fitness pathogen proteins tend to interact more with host cell proteins.

• Membrane functionality: Given its predicted membrane association, KPN78578_47350 may contribute to membrane integrity under host-imposed stress conditions.

• Host interaction: K. pneumoniae proteins have been shown to target host immune signaling, proteasomal degradation, and mRNA processing pathways . KPN78578_47350 may play a role in subverting these host defense mechanisms.

• Environmental adaptation: The protein may contribute to adaptation to specific niches within the host, similar to how type IV pilus confers selective advantages to uropathogenic E. coli in the urinary tract .

• Stress response: It may participate in bacterial responses to host-imposed stresses like nutrient limitation, immune attack, or antibiotic exposure.

Experimental approaches to test these hypotheses could include competitive infection assays with wild-type and knockout strains, transcriptional profiling during infection, and host-pathogen protein interaction studies.

What are the major challenges in expressing and working with membrane-associated bacterial proteins like KPN78578_47350?

Working with predicted membrane-associated proteins like KPN78578_47350 presents several technical challenges:

• Expression optimization: Membrane proteins often require specialized expression systems that can properly insert them into membranes. Optimization may involve:

  • Testing different E. coli strains specialized for membrane protein expression

  • Using lower induction temperatures (16-20°C)

  • Employing weaker promoters to prevent aggregation

  • Considering cell-free expression systems

• Solubility issues: Membrane proteins may form inclusion bodies or aggregate during expression. Strategies include:

  • Addition of solubilizing tags (beyond the His-tag)

  • Co-expression with chaperones

  • Use of specific detergents during purification

• Purification complexity: Membrane proteins require detergents or amphipols to maintain solubility after extraction from membranes.

• Structural characterization difficulties: Traditional structural biology methods may be challenging, requiring specialized approaches like:

  • Detergent screening for optimal protein stability

  • Lipid nanodiscs or other membrane mimetics

  • Specialized crystallization techniques for membrane proteins

• Functional assays: Testing function may require reconstitution into artificial membranes or liposomes.

These challenges necessitate careful optimization of protocols specific to KPN78578_47350's characteristics.

How can researchers overcome limitations in studying KPN78578_47350-host protein interactions?

Overcoming limitations in host-pathogen protein interaction studies requires innovative approaches:

• Computational prediction refinement: Improving homology-based predictions by incorporating structural information and machine learning approaches .

• Split reporter systems: Modified bacterial two-hybrid or split-GFP systems adapted for membrane proteins.

• Proximity labeling: Methods like BioID or APEX2 can identify proteins in close proximity to KPN78578_47350 in living cells.

• Surface plasmon resonance (SPR): For quantitative measurement of binding kinetics between purified proteins.

• Cryo-electron tomography: To visualize protein complexes at host-pathogen interfaces.

• Protein fragment complementation assays: Specifically designed for membrane protein interactions.

• Cell-based screens: Systematic testing of KPN78578_47350 against arrays of human proteins expressed in mammalian cells.

• CRISPR screens: Identifying host factors whose deletion affects KPN78578_47350-mediated phenotypes.

These approaches can be complementary, with computational predictions guiding targeted experimental validation.

What considerations should be made when designing mutation studies for KPN78578_47350?

When designing mutation studies for KPN78578_47350, several important considerations should be addressed:

• Target selection strategy:

  • Focus on conserved residues across bacterial species

  • Target predicted functional domains or membrane-spanning regions

  • Consider residues predicted to be involved in host interactions

  • Include control mutations in presumably non-essential regions

• Mutation types:

  • Alanine scanning for systematic functional mapping

  • Conservative vs. non-conservative substitutions

  • Domain swapping with homologous proteins

  • Truncation mutants to identify essential regions

• Expression and stability controls:

  • Verify proper expression of all mutants

  • Assess protein folding and stability to distinguish functional from structural effects

  • Confirm proper membrane localization for membrane-spanning mutants

• Functional readouts:

  • Develop quantifiable assays for protein function

  • Consider bacterial fitness measurements under various stresses

  • Assess host cell interaction capabilities

• Deep mutational scanning considerations:

  • Library construction methods to ensure comprehensive coverage

  • Selection conditions that reflect relevant biological pressures

  • Sequencing depth sufficient to detect epistatic effects

These considerations will help ensure that mutation studies provide meaningful insights into KPN78578_47350 structure-function relationships.