Recombinant Klebsiella pneumoniae subsp. pneumoniae UPF0756 membrane protein KPN78578_11500 (KPN78578_11500)

Shipped with Ice Packs
In Stock

Description

Introduction to UPF0756 Membrane Protein KPN78578_11500

UPF0756 membrane protein KPN78578_11500 is a protein encoded by the Klebsiella pneumoniae subspecies pneumoniae genome. It belongs to the UPF0756 family, a classification given to proteins with currently unknown functions but with conserved sequences suggesting biological significance. This protein is specifically associated with the strain ATCC 700721 / MGH 78578, a clinical isolate that has been fully sequenced and serves as a reference strain for Klebsiella pneumoniae research .

Klebsiella pneumoniae is an important Gram-negative bacterial pathogen responsible for various community-acquired and nosocomial infections, particularly pneumonia. The bacterium is known for its remarkable ability to evade host immune responses, partially attributed to its capsular polysaccharide (CPS) and various membrane proteins . While outer membrane protein A (OmpA) has been extensively studied for its role in immune evasion, other membrane proteins like KPN78578_11500 remain less characterized but potentially significant in bacterial physiology and pathogenesis.

The protein is referenced in protein databases with the UniProt accession number A6T7P0, providing a standardized identification for research and cross-referencing purposes . Its gene is designated as KPN78578_11500 (Ordered Locus Name) and KPN_01178 (ORF Name), indicating its genomic location and identification within the bacterial chromosome .

Classification and Identification

As a membrane protein, KPN78578_11500 is part of the complex proteome embedded within the bacterial cell envelope. Membrane proteins generally play crucial roles in cellular processes including transport, signaling, enzymatic activity, and structural integrity. The classification of membrane proteins has been an area of active research, with various computational approaches being developed to predict and categorize these proteins based on their structural and functional properties .

Computational Structure Modeling

In the absence of experimentally determined structures, computational modeling has provided insights into the three-dimensional architecture of this protein. The AlphaFold Database has generated a computed structure model (designated AF-A6T7P0-F1) for this protein, which was released on December 9, 2021, and last modified on September 30, 2022 .

Physicochemical Properties

The UPF0756 membrane protein KPN78578_11500 has a molecular weight of approximately 15,337 Daltons, placing it in the range of small to medium-sized proteins . This molecular weight is consistent with its 148-amino acid sequence length and is typical for many bacterial membrane proteins with relatively simple structures and functions.

Sequence Conservation and Homology

As a member of the UPF0756 family, this protein likely shares sequence homology with similar proteins in other bacterial species. Sequence conservation across species can provide insights into evolutionarily important functional regions of the protein. The classification within the UPF0756 family suggests functional significance despite the current lack of detailed functional characterization .

Table 1: Key Molecular Properties of UPF0756 Membrane Protein KPN78578_11500

PropertyValueSource
UniProt AccessionA6T7P0
Sequence Length148 amino acids
Molecular Weight15,337 Da
Expression Region1-148 (full length)
AlphaFold Model IDAF-A6T7P0-F1
Model Confidence (pLDDT)83.19 (Confident)

Research Applications

While specific functions of this protein have not been fully characterized, recombinant versions are valuable for various research applications. These may include:

  1. Structural studies to determine the three-dimensional architecture of the protein

  2. Functional assays to elucidate the protein's role in bacterial physiology

  3. Immunological studies to investigate host-pathogen interactions

  4. Development of diagnostic tools for Klebsiella pneumoniae detection

  5. Screening for antimicrobial compounds that may target this membrane protein

The protein is specifically labeled for research use only and not intended for diagnostic procedures or therapeutic applications .

Relation to Other Klebsiella Membrane Proteins

While the specific function of UPF0756 membrane protein KPN78578_11500 remains undetermined, other membrane proteins in Klebsiella pneumoniae have been better characterized. For example, Outer Membrane Protein A (OmpA) has been demonstrated to play a significant role in immune evasion, contributing to the pathogen's ability to establish infection in the host .

Studies have shown that OmpA is important for the attenuation of airway cell responses, which may facilitate pathogen survival in the hostile environment of the lung. OmpA mutants induce higher levels of inflammatory cytokines and are attenuated in mouse models of pneumonia . Whether UPF0756 membrane protein KPN78578_11500 plays a similar or complementary role in pathogenesis remains to be determined.

Classification Approaches for Membrane Proteins

The classification of membrane proteins has been approached using various computational methods, including Decision Tree (DT) algorithms . These classification methods are important for predicting protein types and functions, particularly for proteins that have not been experimentally characterized. Multi-label classification is especially relevant for membrane proteins, which often perform multiple cellular processes and functions simultaneously .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we currently have in stock. If you have a specific format preference, kindly indicate your requirement when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery time information, please consult your local distributors.
Please note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
KPN78578_11500; KPN_01178; UPF0756 membrane protein KPN78578_11500
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Target Names
KPN78578_11500
Target Protein Sequence
MFDTTLLILLGLAALGFISHNTTVAISILVLIIVRVTPLNAFFPWVEKQGLTVGIIILTI GVMAPIASGTLPPSTLIHSFMNWKSLLAIAVGVFVSWLGGRGVSLMGSQPHLVAGLLVGT VLGVALFRGVPVGPLIAAGIISLFIGKS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0756 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0756 membrane protein KPN78578_11500 and what is its significance in research?

The UPF0756 membrane protein KPN78578_11500 is a transmembrane protein found in Klebsiella pneumoniae subsp. pneumoniae strain ATCC 700721/MGH 78578. This 148-amino acid protein belongs to the UPF0756 protein family, a group of uncharacterized proteins with predicted membrane localization. Its amino acid sequence suggests a structure with multiple transmembrane domains that likely plays a role in cellular membrane integrity or transport functions .

The significance of this protein in research stems from K. pneumoniae's status as a major opportunistic pathogen responsible for healthcare-associated infections, increasingly complicated by antimicrobial resistance . Membrane proteins like KPN78578_11500 often serve as potential targets for antimicrobial development and may contribute to virulence factors or resistance mechanisms.

What are the optimal storage and handling conditions for recombinant KPN78578_11500?

For optimal preservation of structural integrity and functionality, recombinant KPN78578_11500 should be stored according to the following protocol:

  • Long-term storage: Maintain at -20°C to -80°C in a Tris-based buffer with 50% glycerol .

  • Working aliquots: Store at 4°C for up to one week to minimize protein degradation .

  • Avoid repeated freeze-thaw cycles: These can significantly compromise protein stability and activity .

  • Reconstitution: If lyophilized, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Aliquoting: For proteins requiring frequent use, prepare small working aliquots with 5-50% glycerol as a cryoprotectant .

For handling during experiments, maintain the protein on ice when thawed and use aseptic techniques to prevent contamination that could lead to degradation.

What expression systems are most effective for producing recombinant KPN78578_11500?

Based on empirical data from similar membrane proteins in the UPF0756 family, the following expression systems have proven effective:

E. coli-based expression systems:

  • BL21(DE3) strain has demonstrated high expression levels for similar K. pneumoniae membrane proteins .

  • The pET vector system with T7 promoter provides controlled and high-yield expression .

Expression optimization parameters:

ParameterOptimal RangeEffect on Expression
IPTG concentration0.1-1.0 mMHigher concentrations may lead to inclusion body formation
Induction temperature16-25°CLower temperatures favor soluble expression
Induction time4-6 hoursLonger times don't necessarily increase yield
Media compositionLB or 2xYT with supplementsEnriched media can improve expression
Cell density at inductionOD600 of 0.6-0.8Critical for optimal expression

Employing a multivariant experimental design approach rather than single-variable optimization is strongly recommended for maximizing expression efficiency .

What strategies can improve the soluble expression of KPN78578_11500?

Membrane proteins like KPN78578_11500 often present challenges for soluble expression. Implement these evidence-based strategies to enhance solubility:

  • Fusion tags selection:

    • N-terminal His-tag has shown effectiveness for UPF0756 family proteins .

    • Consider solubility-enhancing fusion partners like MBP, SUMO, or Thioredoxin if His-tag alone proves insufficient.

  • Expression conditions optimization:

    • Apply factorial design experimental methodology to simultaneously evaluate multiple variables .

    • Consider a fractional factorial screening design (2^8-4) with multiple replicates at central points to efficiently identify optimal conditions .

  • Co-expression with chaperones:

    • GroEL/GroES or DnaK/DnaJ/GrpE systems can facilitate proper folding.

    • Evaluate chaperone effectiveness through activity assays.

  • Membrane-mimetic additives:

    • Add non-ionic detergents (0.1-0.5% Triton X-100 or NP-40) to lysis buffers.

    • Include glycerol (5-10%) to stabilize protein structure.

From experimental design studies with similar proteins, maintaining induction time at 4 hours has been shown to achieve the highest productivity of recombinant membrane proteins while minimizing operational time .

How can recombinant KPN78578_11500 be applied in antimicrobial resistance studies?

Recombinant KPN78578_11500 can serve as a valuable tool in several aspects of antimicrobial resistance (AMR) research:

  • Structure-function relationship studies:

    • Investigate potential roles in membrane permeability and antibiotic influx/efflux.

    • Examine interactions with existing antibiotics through binding assays.

  • Comparative genomics approaches:

    • Analyze sequence variations between strains with different AMR profiles.

    • Whole-genome sequencing data indicates that K. pneumoniae exhibits diverse antimicrobial resistance phenotypes with plasmid-borne genes playing a major role .

  • Epidemiological investigations:

    • Assess expression levels in clinical isolates with varied resistance profiles.

    • Studies have shown that ESBL-positive strains have a 28% risk of nosocomial transmission versus 1.7% for ESBL-negative strains .

  • Novel therapeutic target development:

    • Utilize the recombinant protein for high-throughput screening of inhibitory compounds.

    • Develop antibody-based detection systems for diagnostic applications.

Implementing these approaches requires careful experimental design with appropriate controls and standardized methodologies to ensure reproducibility across studies.

What are the methodological considerations for integrating KPN78578_11500 into K. pneumoniae pathogenicity studies?

When incorporating recombinant KPN78578_11500 into pathogenicity studies, researchers should consider:

  • Protein functional validation:

    • Confirm proper folding and activity before experimental use.

    • Verify membrane association properties through fractionation studies.

  • Infection model selection:

    • In vitro: Human epithelial cell lines, immune cell co-culture systems.

    • In vivo: Mouse models of pneumonia, urinary tract infection, or systemic infection.

  • Experimental design framework:

    • Control for strain variation as K. pneumoniae clinical isolates show significant diversity .

    • Account for the 18% diversity within the K. pneumoniae species complex identified in hospital surveillance studies .

  • Molecular interaction studies:

    • Investigate potential interactions with host cell receptors.

    • Examine participation in biofilm formation, which contributes to persistence.

Research has demonstrated that specific genomic features of K. pneumoniae are associated with nosocomial onset, including rhamnose-positive capsules (OR 3.12, p < 0.001) and ESBLs (OR 2.34, p = 0.015) . This knowledge should inform experimental design when studying membrane proteins in the context of hospital-acquired infections.

What analytical techniques are most effective for studying membrane protein-protein interactions involving KPN78578_11500?

Advanced analytical techniques for investigating KPN78578_11500 interactions include:

  • Crosslinking mass spectrometry (XL-MS):

    • Employs chemical crosslinkers to capture transient interactions.

    • Provides spatial constraints for modeling interaction interfaces.

    • Sample preparation must account for the hydrophobic nature of membrane proteins.

  • Biolayer interferometry (BLI):

    • Allows label-free, real-time measurement of protein-protein interactions.

    • Can determine kinetic parameters (kon, koff) and binding affinities (KD).

    • Requires immobilization strategies compatible with membrane proteins.

  • FRET-based assays:

    • Enable detection of interactions in native-like membrane environments.

    • Can be applied to both purified proteins and cellular systems.

    • Consider fluorophore placement to avoid disrupting interaction interfaces.

  • Co-immunoprecipitation coupled with quantitative proteomics:

    • Identifies interaction partners from complex biological samples.

    • Requires optimization of detergent conditions to maintain protein solubility.

    • Statistical validation using multiple biological replicates is essential.

These techniques should be applied within a framework of statistical experimental design to account for multiple variables and their interactions, similar to approaches used for optimizing protein expression .

How can researchers address the challenges in structural characterization of KPN78578_11500?

Structural characterization of membrane proteins like KPN78578_11500 presents unique challenges. Implement these methodological approaches:

  • Protein stabilization strategies:

    • Detergent screening: Systematic evaluation of detergent types and concentrations.

    • Nanodiscs or lipid cubic phase methods for maintaining native-like environments.

    • Thermostability assays to identify optimal buffer conditions.

  • Structural determination methods:

    • X-ray crystallography: Requires extensive crystallization condition screening.

    • Cryo-EM: Single-particle analysis or tomography for membrane protein structures.

    • NMR spectroscopy: Solution or solid-state approaches for dynamic information.

  • Computational approaches:

    • Homology modeling using related structures as templates.

    • Molecular dynamics simulations to study conformational dynamics.

    • Integration of experimental constraints from limited proteolysis and crosslinking.

  • Method-specific considerations:

MethodAdvantagesLimitationsOptimization Strategies
X-ray crystallographyHigh resolutionDifficult crystallizationFusion with crystallization chaperones
Cryo-EMNo crystallization neededResolution challengesDetergent optimization, antibody fragments
NMRDynamic informationSize limitationsSelective isotope labeling, TROSY techniques

Each approach should employ statistical design of experiments to systematically evaluate multiple parameters simultaneously rather than traditional one-variable-at-a-time methods .

What statistical approaches are recommended for analyzing experimental data from KPN78578_11500 studies?

  • Experimental design optimization:

    • Implement factorial designs to efficiently evaluate multiple variables and their interactions .

    • For complex multi-parameter experiments, consider fractional factorial designs to reduce experimental burden while maintaining statistical power .

    • Include appropriate replications at central points to estimate experimental error .

  • Multivariate data analysis:

    • Principal Component Analysis (PCA) for dimensionality reduction.

    • Partial Least Squares (PLS) regression for correlating protein properties with experimental conditions.

    • Response Surface Methodology (RSM) for optimization of experimental conditions.

  • Statistical validation requirements:

    • Power analysis to determine appropriate sample sizes.

    • Normality tests and transformation of non-normal data when necessary.

    • Multiple comparison corrections (e.g., Bonferroni, FDR) for high-throughput experiments.

  • Reproducibility considerations:

    • Report both biological and technical variability separately.

    • Standardize data normalization procedures.

    • Document all analysis parameters to enable replication.

The multivariant approach has demonstrated advantages over traditional univariate methods, enabling efficient characterization of experimental error and comparison of variable effects when normalized .

How can researchers ensure reproducibility in KPN78578_11500 experimental studies?

Ensuring reproducibility in membrane protein research requires rigorous methodological approaches:

  • Comprehensive documentation:

    • Detailed protocols including buffer compositions, incubation times, and temperatures.

    • Complete reporting of all variable parameters, including those held constant.

    • Precise description of protein batch characterization (purity, activity).

  • Quality control measures:

    • Implement protein integrity verification before each experiment.

    • Establish acceptance criteria for experimental results.

    • Maintain consistent source materials across studies.

  • Standardization approaches:

    • Use reference standards when available.

    • Implement internal controls for normalization.

    • Adopt community-accepted protocols for common procedures.

  • Data sharing practices:

    • Deposit raw data in appropriate repositories.

    • Share analysis scripts and computational pipelines.

    • Provide sufficient metadata for experimental context.

  • Statistical robustness:

    • Report effect sizes alongside p-values.

    • Conduct sensitivity analyses for key parameters.

    • Consider pre-registration of experimental designs for hypothesis-testing studies.

These approaches align with modern biomedical research standards and address the challenges identified in experimental design for recombinant protein expression .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.