Recombinant Klebsiella pneumoniae subsp. pneumoniae Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If a particular tag type is required, please inform us, and we will prioritize its development.
Synonyms
zntB; KPN78578_13440; KPN_01373; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Target Names
zntB
Target Protein Sequence
MDAIKGSELQIPDAIFAWVLDGQGGVKPLADDDIIDKDKPCWLHLNYTHSDSADWLAATP LLPNNVRDALAGESTRPRVTRIGDGALITLRCINGSTDERPDQLVAMRLYMDERLIVSTR QRKVLALDDVLGDLKEGNGPTDGGSWLVEVCDALTDHASEFIEQLHDRIIDLEDDLLDQQ VPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIAERLGRGLDE IDSCIARTAIMSDEIAQIMQESLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGNSWH LGFSLFCLMLVVVIGGVAWWLHRSKWL
Uniprot No.

Target Background

Function
Mediates zinc ion efflux.
Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of Zinc Transport Protein ZntB in Klebsiella pneumoniae?

The protein functions as a pentameric transporter embedded in the bacterial membrane, utilizing a proton gradient to drive zinc efflux. Structural studies have revealed that ZntB contains multiple zinc-binding sites, which facilitate its role in zinc transport . In pathogenic bacteria like Klebsiella pneumoniae, zinc homeostasis is also linked to virulence, as the bacterium must adapt to host-imposed zinc limitation during infection .

How does the structure of ZntB contribute to its function as a zinc transporter?

The structure of ZntB is integral to its function as a zinc transporter. Cryo-electron microscopy and X-ray crystallography studies have shown that ZntB forms a homopentameric complex, with each monomer contributing to the central pore through which zinc ions are transported . The pore's cylindrical shape and specific amino acid residues within the funnel region are critical for coordinating zinc ions.

Key structural features include:

  • Zinc-binding sites: Three distinct binding sites have been identified in each monomer, with specific residues such as histidines and cysteines coordinating zinc ions .

  • Proton-coupled transport mechanism: The transport activity of ZntB is driven by a proton gradient across the membrane. Mutagenesis studies have confirmed that certain amino acids are essential for proton binding and coupling to zinc transport .

  • Conformational states: Structural analyses suggest that ZntB can exist in open and closed conformations, which may regulate its transport activity. Unlike its homolog CorA, ZntB exhibits a cylindrical pore rather than a tapered one, potentially reflecting differences in transport mechanisms .

These structural insights provide a foundation for understanding how ZntB mediates selective and efficient zinc efflux.

What experimental methods are used to study the function of ZntB?

The function of ZntB has been investigated using a combination of biochemical, biophysical, and molecular biology techniques:

  • Isothermal Titration Calorimetry (ITC): ITC has been employed to measure the binding affinity of ZntB for zinc ions and other divalent cations. This method provides quantitative data on thermodynamic parameters such as binding constants and enthalpy changes .

  • Radio-ligand Uptake Assays: These assays involve reconstituting ZntB into liposomes and measuring the uptake or efflux of radiolabeled zinc ions under various conditions (e.g., different pH gradients) .

  • Fluorescence-based Transport Assays: Fluorescent dyes sensitive to pH or metal ion concentrations have been used to monitor real-time transport activity in proteoliposomes containing ZntB .

  • Mutagenesis Studies: Site-directed mutagenesis has been applied to identify key residues involved in proton coupling and zinc coordination. Functional assays on mutant proteins help elucidate the molecular mechanism of transport .

  • Structural Studies: High-resolution techniques such as cryo-electron microscopy and X-ray crystallography have provided detailed insights into the architecture of ZntB and its conformational states during transport .

These methodologies collectively enable researchers to dissect the mechanistic details of ZntB's function.

How does pH influence the activity of ZntB?

The activity of ZntB is strongly influenced by pH gradients across the bacterial membrane. Experimental evidence indicates that ZntB functions as a proton-coupled transporter, where proton movement down its concentration gradient drives the efflux of zinc ions against their concentration gradient .

In vitro studies using proteoliposomes have demonstrated that:

  • A higher external pH (alkaline environment) enhances zinc efflux by providing a stronger driving force for proton movement.

  • Mutations in amino acid residues involved in proton binding significantly impair transport activity, confirming the role of protons in coupling .

These findings highlight the importance of pH homeostasis in regulating ZntB activity and suggest potential vulnerabilities that could be targeted in antimicrobial strategies.

What are the implications of ZntB function for Klebsiella pneumoniae virulence?

Zinc homeostasis mediated by ZntB is closely linked to the virulence of Klebsiella pneumoniae. During infection, host organisms often impose nutritional immunity by sequestering essential metals like zinc to limit bacterial growth. In response, Klebsiella pneumoniae employs specialized transport systems like ZntB to scavenge or regulate intracellular zinc levels .

Key implications include:

  • Adaptation to host environments: By maintaining optimal intracellular zinc levels, ZntB enables Klebsiella pneumoniae to survive under hostile conditions imposed by host defenses.

  • Biofilm formation: Zinc regulation may influence biofilm formation, which enhances bacterial persistence on surfaces and resistance to antibiotics.

  • Antibiotic resistance: Zinc-dependent enzymes such as β-lactamases contribute to antibiotic resistance mechanisms. Proper functioning of ZntB ensures sufficient availability of zinc for these enzymes .

Understanding these connections provides insights into how disrupting zinc homeostasis could attenuate bacterial virulence.

Are there contradictions or gaps in current data on ZntB?

Yes, there are notable contradictions and gaps in current data on ZntB:

  • Transport Mechanism: While most studies support a proton-coupled mechanism for zinc efflux, some structural data suggest alternative interpretations. For example, low-resolution structures obtained in the presence of cadmium or zinc ions have been difficult to reconcile with functional assays .

  • Substrate Specificity: Although primarily described as a zinc transporter, ZntB has been shown to transport other divalent cations like nickel and cobalt under certain conditions. The physiological relevance of this promiscuity remains unclear .

  • Regulatory Mechanisms: Little is known about how ZntB activity is regulated at the transcriptional or post-translational level during different stages of infection or environmental stress.

Addressing these gaps will require further integration of structural biology with functional genomics and proteomics approaches.

How can researchers design experiments to investigate novel aspects of ZntB?

To explore novel aspects of ZntB function or regulation, researchers can consider the following experimental designs:

  • High-throughput Mutagenesis: Generate libraries of point mutants targeting conserved residues within the transmembrane domain or cytoplasmic regions. Screen these mutants for altered transport activity using fluorescence-based assays.

  • Single-molecule Studies: Utilize advanced imaging techniques like single-molecule FRET (Förster Resonance Energy Transfer) to observe conformational changes in real-time during transport cycles.

  • Host-pathogen Interaction Models: Study Klebsiella pneumoniae mutants lacking functional ZntB in animal models or organoids mimicking human tissues to assess virulence under nutrient-limited conditions.

  • Comparative Genomics: Analyze homologs of ZntB across different bacterial species to identify conserved features or unique adaptations relevant to pathogenicity.

  • Chemical Probes: Develop small-molecule inhibitors targeting key residues within the pore region or proton-binding sites based on structural data.

By combining these approaches with existing methodologies, researchers can uncover new dimensions of ZntB biology.

What challenges do researchers face when studying recombinant forms of ZntB?

Studying recombinant forms of membrane proteins like ZntB presents several challenges:

  • Protein Expression and Purification: Achieving high-yield expression while maintaining proper folding and functionality can be difficult due to toxicity or instability in heterologous systems.

  • Reconstitution into Membranes: Functional assays often require reconstitution into artificial membranes (liposomes), which may not fully replicate native lipid environments.

  • Structural Heterogeneity: Membrane proteins can adopt multiple conformational states, complicating structural analyses using techniques like cryo-electron microscopy.

  • Functional Validation: Ensuring that recombinant proteins exhibit native-like activity is critical but challenging without robust controls.

Overcoming these challenges necessitates optimization at every step—from gene cloning to functional characterization—and often requires interdisciplinary collaboration.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.