Recombinant Klebsiella pneumoniae Sulfoxide reductase heme-binding subunit YedZ (yedZ)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Physiology

YedZ is a heme-binding subunit critical for sulfoxide reductase activity and interacts with divalent cations (Ca²⁺, Mg²⁺) to maintain membrane stability . Key functional insights include:

  • DedA Family Redundancy: YedZ homologs (YqjA, YghB) share >90% amino acid identity in K. pneumoniae and are required for alkaline pH tolerance, thermotolerance (growth at 42°C), and divalent cation homeostasis .

  • Capsule Biosynthesis: Deletion of yqjA and yghB in K. pneumoniae disrupts undecaprenyl phosphate recycling, impairing polysaccharide capsule formation—a key virulence factor .

  • Antibiotic Resistance Link: YedZ-deficient mutants show sensitivity to EDTA, SDS, and chloroquine but retain resistance to most antibiotics .

Implications in Virulence and Pathogenesis

Table 2: Phenotypic Effects of YedZ/YqjA/YghB Deletion in K. pneumoniae

PhenotypeObservation
Capsule DefectReduced undecaprenyl phosphate availability leads to 50% lower capsule content .
PhagocytosisMutants (e.g., VT201) exhibit 3× higher uptake by alveolar macrophages .
Calcium UptakeImpaired calcium transport, reversible with 0.5–2 mM Ca²⁺/Mg²⁺ supplementation .

Research on Antibiotic Resistance Mechanisms

While YedZ itself is not directly linked to antibiotic resistance, its homolog DkcA (DedA family) is critical for colistin resistance in K. pneumoniae . Notably:

  • Convergent Strains: Hypervirulent K. pneumoniae lineages (e.g., ST258, ST23) acquiring carbapenemase genes (blaKPC-2) highlight risks of resistance-virulence convergence .

  • ESBL Association: Extended-spectrum β-lactamase (ESBL)-producing strains show higher nosocomial transmission rates (OR = 21) .

Clinical and Therapeutic Implications

  • Diagnostic Potential: YedZ homologs are biomarkers for divalent cation dysregulation in infections .

  • Therapeutic Targeting: Compounds disrupting DedA family function could reduce virulence by impairing capsule synthesis or cation transport .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific requirement for the format, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
msrQ; KPK_0455; Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ; Flavocytochrome MsrQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Klebsiella pneumoniae (strain 342)
Target Names
msrQ
Target Protein Sequence
MRFTVKQIAWLKVFLHLAGFLPLVWLFWAGHQGYFSADPAKDIQHFTGRMALKFLLATLL VAPLARYAKQPLLIRIRRLLGLWCFAWATLHLTSYTLLELGINNLALLGSEIINRPYLTL GMICWVILLALAATSTQAMQRKLGRRWQLLHNFVYLVAILAPIHYLWSVKIVSPQPIIYA LLAVVLLACRYKKFRQWWR
Uniprot No.

Target Background

Function
YedZ, a component of the MsrPQ system, plays a crucial role in repairing oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O). It utilizes respiratory chain electrons to restore these proteins, safeguarding them from oxidative stress damage caused by reactive oxygen and chlorine species generated during host defense mechanisms. The MsrPQ system is essential for maintaining envelope integrity under bleach stress, rescuing a diverse range of structurally unrelated periplasmic proteins from methionine oxidation. MsrQ provides electrons for reduction to the reductase catalytic subunit MsrP, leveraging the quinone pool of the respiratory chain.
Database Links

KEGG: kpe:KPK_0455

Protein Families
MsrQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What cofactor does YedZ contain and how was this determined?

YedZ contains a heme b cofactor, which was confirmed through multiple analytical techniques:

  • Spectroscopic analysis: Under reducing conditions, the optical spectrum of purified YedZ shows a maximum at 558 nm, which is characteristic of cytochrome b .

  • Mass spectrometry: MS analysis revealed that YedZ contains a cofactor with a molecular weight of 617 Da, corresponding to the mass of heme b .

  • Pyridine hemechromogen assay: This technique confirmed that YedZ contains a single heme molecule .

The orange color observed in cells overexpressing YedZ-GFP, as well as in the purified protein, provided the initial indication of a potential cofactor presence .

How do researchers hypothesize YedZ functions in bacterial systems?

Based on structural features and experimental evidence, YedZ is proposed to function in several related processes:

  • Oxidoreduction processes: The heme cofactor suggests a role in electron transfer reactions .

  • Transmembrane electron flow: The transmembrane structure with histidine residues positioned to coordinate heme suggests YedZ may participate in electron transfer across membranes .

  • Transport facilitation: YedZ shows sequence similarity to putative heme export systems, suggesting a potential role in transport processes .

  • Component of sulfoxide reduction systems: The protein is also known as MsrQ (methionine sulfoxide reductase Q), indicating a potential role in reducing oxidized methionine residues in proteins .

Fusion proteins containing YedZ domains have been identified in magnetotactic bacteria and cyanobacteria, where YedZ is fused to transport and electron transfer proteins respectively, further supporting these functional hypotheses .

What expression systems yield functional recombinant YedZ protein?

The most effective expression system documented for recombinant YedZ production is Escherichia coli. Several approaches have proven successful:

  • GFP-fusion approach: A GFP-based pipeline for membrane protein overexpression has been used successfully for YedZ characterization. The GFP tag allows monitoring of expression, folding, and purification efficiency in real-time .

  • His-tagged constructs: Most commercial recombinant YedZ proteins feature N-terminal His-tags to facilitate purification .

Expression considerations include:

  • Host strain: E. coli has been used successfully for both K. pneumoniae and E. coli YedZ expression

  • Induction conditions: These should be optimized to prevent aggregation of this membrane protein

  • Membrane extraction: Proper detergent selection is critical for maintaining protein structure and function

What purification strategies yield high-purity active YedZ protein?

Successful purification of YedZ requires special consideration of its membrane-integral nature. The following strategies have proven effective:

  • Affinity chromatography: His-tagged YedZ can be purified using Ni-NTA or similar metal affinity resins .

  • Detergent solubilization: Proper detergent selection is critical for extracting YedZ from membranes while maintaining its native fold and cofactor binding .

  • GFP-based approach: The GFP-fusion strategy allows visual tracking of the protein during purification and can be combined with protease cleavage to remove the tag .

A typical purification protocol involves:

  • Membrane fraction isolation

  • Detergent solubilization

  • Affinity chromatography

  • Optional size exclusion chromatography for further purification

The orange color of purified YedZ provides a visual indication of proper folding and heme incorporation .

What are the optimal storage conditions for maintaining YedZ stability?

Based on commercial product information and research protocols, the following storage conditions are recommended for YedZ:

  • Temperature: Store at -20°C or -80°C for extended storage .

  • Buffer composition: Tris/PBS-based buffer with 6% trehalose, pH 8.0 is commonly used .

  • Glycerol addition: Addition of 5-50% glycerol (commonly 50%) as a cryoprotectant is recommended .

  • Working aliquots: For short-term use, working aliquots can be stored at 4°C for up to one week .

  • Avoid freeze-thaw cycles: Repeated freezing and thawing should be avoided to maintain protein integrity .

For reconstitution, it is recommended to briefly centrifuge the vial prior to opening and reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

What spectroscopic methods are most informative for characterizing YedZ and its heme cofactor?

Several spectroscopic techniques provide valuable information about YedZ and its heme cofactor:

  • UV-Visible absorption spectroscopy: This technique reveals characteristic absorption peaks under oxidizing and reducing conditions. Under reducing conditions, YedZ shows a maximum at 558 nm, typical of cytochrome b .

  • Pyridine hemechromogen assay: This method can determine the type and stoichiometry of heme in the protein. It has confirmed that YedZ contains a single heme b molecule .

  • Redox potential measurements: These can be conducted using spectroelectrochemical methods to determine the midpoint potential of the heme cofactor.

  • Resonance Raman spectroscopy: Although not explicitly mentioned in the search results, this technique would provide information about the heme environment and coordination state.

How can researchers analyze the membrane topology and structural features of YedZ?

Several approaches have been employed to determine YedZ's membrane topology and structural features:

  • GFP-fusion topology mapping: This approach uses the principle that GFP folds properly only when expressed in the cytoplasm. By creating fusions at different positions, researchers determined that both N- and C-termini of YedZ are located in the cytoplasm .

  • Hydropathy analysis: Computational methods have predicted the presence of six transmembrane segments connected by short loops .

  • Sequence conservation analysis: Alignment of YedZ homologues has identified conserved histidyl residues in the transmembrane domains that likely coordinate the heme cofactor .

  • Evolutionary analysis: Sequence similarity studies have shown that YedZ arose through intragenic triplication of a 2 TMS-encoding element .

For detailed structural studies, researchers might also consider:

  • Cryo-electron microscopy

  • X-ray crystallography (challenging for membrane proteins)

  • Molecular dynamics simulations

What techniques can identify YedZ interactions with other proteins in the cell?

Although the search results don't explicitly mention protein-protein interaction studies with YedZ, researchers could employ these approaches:

  • Co-immunoprecipitation: Using antibodies against YedZ to pull down interacting proteins.

  • Bacterial two-hybrid system: Modified for membrane proteins to identify potential binding partners.

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry to identify proteins in close proximity to YedZ.

  • Co-purification studies: Identifying proteins that co-purify with tagged YedZ under mild solubilization conditions.

  • Genetic approaches: Screening for suppressor mutations or synthetic phenotypes with YedZ mutations.

The operon structure provides clues to potential interactions - YedZ is coded in the same operon as YedY, a periplasmic molybdoenzyme , suggesting these proteins may function together.

How does YedZ compare between Klebsiella pneumoniae and Escherichia coli?

Comparison of YedZ from K. pneumoniae and E. coli reveals both similarities and differences:

FeatureK. pneumoniae YedZE. coli YedZ
Length199-202 amino acids 211 amino acids
Transmembrane domains6 TMS 6 TMS
CofactorHeme b Heme b
Alternative namesMsrQ, Flavocytochrome YedZ MsrQ, Flavocytochrome MsrQ
UniProt IDB5XNE5 (strain 342) , A6TES0 (subsp. pneumoniae) B7MW36 (O81)
Sequence identity-High, but with strain variations
FunctionProposed roles in sulfoxide reduction, electron transfer Same proposed functions

What role does YedZ play in pathogenicity and virulence of Klebsiella pneumoniae?

While the search results don't directly address YedZ's role in K. pneumoniae pathogenicity, we can make some inferences:

  • Oxidative stress response: As a component of the methionine sulfoxide reduction system (MsrQ), YedZ may contribute to bacterial survival under oxidative stress conditions encountered during host infection .

  • Potential virulence factor: The recent emergence of hypervirulent and carbapenem-resistant K. pneumoniae strains has raised concerns about various bacterial components that might contribute to pathogenicity .

  • Evolutionary conservation: The conservation of YedZ across bacterial species suggests an important functional role that may indirectly support virulence through general cellular processes .

Recent research has identified K. pneumoniae as a major pathogen of international concern, capable of causing infections at multiple sites including lungs, urinary tract, bloodstream, wounds, and brain . The transition from colonization to infection is primarily due to impairment of host defense . Further research specifically targeting YedZ's role in this context would be valuable.

How might YedZ function in electron transfer pathways and redox processes?

Based on its structural features and homology relationships, YedZ is hypothesized to function in electron transfer pathways in several ways:

  • Transmembrane electron conduit: The 6 TMS structure with strategically positioned histidine residues capable of coordinating heme suggests YedZ may facilitate electron transfer across the membrane .

  • Component of sulfoxide reduction: As MsrQ, it likely participates in the reduction of methionine sulfoxide, potentially coupling this process to the electron transport chain .

  • Partner with other redox proteins: YedZ is encoded in the same operon as YedY, a periplasmic molybdoenzyme, suggesting functional coupling between these proteins .

  • Relationship to cytochromes: YedZ exhibits sequence similarity to cytochrome-containing electron carriers, supporting a role in redox chemistry .

  • Potential heme transport: Sequence similarity to putative heme export systems suggests YedZ might also facilitate heme transport, which would indirectly support redox processes requiring heme cofactors .

Functional studies using site-directed mutagenesis of conserved histidine residues could provide valuable insights into these proposed roles.

What is known about YedZ homologues across different species?

YedZ homologues show an interesting distribution pattern and structural relationships:

  • Taxonomic distribution: YedZ homologues have been identified in bacteria and animals but are absent in Archaea and other eukaryotic kingdoms .

  • Bacterial homologues: Present in various bacterial species, with interesting variations in magnetotactic bacteria and cyanobacteria where YedZ domains are fused to transport and electron transfer proteins .

  • Animal homologues: Include the 6 TMS epithelial plasma membrane antigen of the prostate (STAMP1) that is overexpressed in prostate cancer. Animal homologues have YedZ domains fused C-terminal to homologues of coenzyme F420-dependent NADP oxidoreductases .

  • Conserved features: All homologues share the 6 TMS structure with conserved histidyl residues positioned in the transmembrane domains, likely for heme binding .

  • Evolutionary origin: YedZ homologues appear to have arisen by intragenic triplication of a 2 TMS-encoding element, an interesting case of protein evolution through internal duplication .

This distribution pattern suggests that YedZ plays fundamental roles in cellular processes that have been conserved across diverse organisms but may have been lost or replaced in certain lineages.

What methodologies are recommended for comparative studies of YedZ from different organisms?

For researchers interested in comparative studies of YedZ proteins from different organisms, several approaches would be valuable:

  • Sequence analysis and phylogenetics:

    • Multiple sequence alignment of YedZ homologues

    • Phylogenetic tree construction to understand evolutionary relationships

    • Conservation analysis to identify key residues

  • Heterologous expression:

    • Expression of YedZ from different organisms in a common host (e.g., E. coli)

    • Comparison of expression levels, stability, and biochemical properties

  • Functional complementation:

    • Testing whether YedZ from one organism can functionally replace YedZ in another

    • Analyzing chimeric proteins with domains from different homologues

  • Structural comparison:

    • Using the GFP-based pipeline for membrane protein characterization

    • Comparing spectroscopic properties of the heme cofactor

  • Genomic context analysis:

    • Examining operon structures and gene neighborhoods

    • Identifying co-evolved components that might function with YedZ

Such comparative studies could provide insights into the evolution of YedZ function and its adaptation to different cellular environments.

How do the fusion proteins containing YedZ domains in specialized bacteria function?

Some of the most interesting YedZ homologues occur as fusion proteins in specialized bacteria:

  • Magnetotactic bacteria: YedZ domains are fused to transport proteins, suggesting a role in specialized transport processes possibly related to magnetosome formation .

  • Cyanobacteria: YedZ domains are fused to electron transfer proteins, emphasizing the role of YedZ in redox chemistry that may be particularly important in photosynthetic organisms .

These fusion proteins likely represent evolutionary adaptations that integrate YedZ's electron transfer or transport capabilities into specialized cellular processes. The fusion event brings together complementary functions, potentially enhancing efficiency through substrate channeling or coordinated regulation.

Research approaches to study these fusion proteins might include:

  • Heterologous expression and purification

  • Domain deletion studies to understand the contribution of each component

  • Spectroscopic characterization to analyze cofactor properties

  • Functional assays relevant to the specialized bacterial processes

Understanding these fusion proteins could provide valuable insights into both YedZ function and the specialized processes in these bacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.