Recombinant Klebsiella pneumoniae Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
arnC; KPK_0267; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Klebsiella pneumoniae (strain 342)
Target Names
arnC
Target Protein Sequence
MLTYPPVKKVSVVIPVYNEQDSLPELLRRTDTACATLGRQYEILLIDDGSSDDSARMLTE AAEAEGSHVVAVLLNRNYGQHSAIMAGFSHVTGDLIITLDADLQNPPEEIPRLVEKADEG YDVVGTVRQNRQDSIFRKSASKMINRLIQRTTGKAMGDYGCMLRAYRRHIIDAMLNCHER STFIPILANTFARRAVEIPVMHAEREFGDSKYSFMRLINLMYDLVTCLTTTPLRLLSIFG SVIALLGFAFGLLLVVLRLAFGPQWAAEGVFMLFAVLFMFIGAQFIGMGLLGEYIGRIYN DVRARPRYFIQRVVRQPETASKEEDRS
Uniprot No.

Target Background

Function

Recombinant Klebsiella pneumoniae Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (ArnC) catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A and is essential for bacterial resistance to polymyxins and cationic antimicrobial peptides.

Database Links

KEGG: kpe:KPK_0267

Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is arnC and what is its functional significance in bacterial antimicrobial resistance?

ArnC is an integral membrane glycosyltransferase that plays a critical role in Gram-negative bacterial resistance to polymyxin antibiotics and cationic antimicrobial peptides. This enzyme catalyzes the attachment of a formylated form of aminoarabinose (L-Ara4N) to undecaprenyl phosphate (UndP), a crucial step in the lipopolysaccharide modification pathway that reduces susceptibility to cationic antimicrobials .

Methodologically, researchers investigating this resistance mechanism typically employ genetic knockout studies, antimicrobial susceptibility testing, and structural biology approaches to correlate arnC function with phenotypic resistance profiles.

What are the structural characteristics of arnC from Klebsiella pneumoniae?

Structural studies of arnC have been conducted using cryo-electron microscopy of the enzyme embedded in lipid nanodiscs. Based on homology with the characterized arnC from Salmonella enterica, the Klebsiella pneumoniae enzyme is expected to share similar structural features . The protein contains:

  • A GT-A glycosyltransferase domain that houses the catalytic site

  • Juxtamembrane (JM) helices that facilitate interaction with the lipid bilayer

  • A DXD motif involved in coordination of divalent metal ions (typically Mn²⁺)

  • A flexible β7-JM2 loop region that undergoes conformational changes upon substrate binding

The enzyme exists in two primary conformational states: an apo form and a nucleotide-bound form. Upon binding of the UDP nucleotide and Mn²⁺, the enzyme undergoes a significant conformational rearrangement characterized by a clamshell-like motion that brings the GT-A domain closer to the juxtamembrane helices .

Structural FeatureFunctionConformational Change Upon Substrate Binding
GT-A domainHouses catalytic siteMoves closer to JM helices
Juxtamembrane helicesMembrane association, UndP threadingRelatively stable
DXD motifMetal coordination and catalysisSubtle repositioning for optimal catalysis
β7-JM2 loopSubstrate coordinationSignificant rearrangement to facilitate UndP positioning

How does arnC interact with its substrates?

ArnC catalyzes the transfer of a formylated aminoarabinose (L-Ara4FN) from UDP-L-Ara4FN to undecaprenyl phosphate (UndP). Molecular dynamics simulations have revealed the detailed interaction process :

  • UndP Threading: The lipid substrate threads through the juxtamembrane helices to reach the catalytic GT-A domain of the enzyme.

  • Substrate Positioning: UndP can occupy two distinct positions within the GT-A domain:

    • Position 1 (P1): A "standby" position where UndP is coordinated by arginine residues R128 and R137

    • Position 2 (P2): A "catalysis" position that enables the nucleophilic attack on the sugar donor

  • Nucleotide Binding: When UDP-L-Ara4FN binds, it triggers a conformational change in the flexible β7-JM2 loop, allowing UndP to move from P1 to P2.

  • Catalytic Reaction: In the P2 position, the phosphate group of UndP is optimally positioned for nucleophilic attack on the C1 carbon of the L-Ara4FN sugar, facilitated by the catalytic base (first aspartate of the DXD motif).

Methodologically, this interaction has been studied using a combination of coarse-grained and atomistic molecular dynamics simulations, which provide dynamic information that complements static structural data from cryo-EM studies .

What expression systems are suitable for recombinant production of arnC?

While the search results don't provide specific details about expression systems for arnC, general principles for membrane glycosyltransferases can be applied. Based on information about related recombinant proteins , potential expression systems include:

Expression SystemAdvantagesLimitationsSpecial Considerations
E. coliHigh yield, easy handling, low costLimited post-translational modificationsMay require specific strains (C41, C43) for membrane proteins
YeastEukaryotic PTMs, high yieldMore complex than E. coliSuitable for proteins requiring glycosylation
BaculovirusComplex PTMs, high yieldTime-consuming, expensiveGood for large or complex membrane proteins
Mammalian cellsNative-like PTMs and foldingLow yield, expensiveBest for proteins requiring complex PTMs

For membrane proteins like arnC, methodological considerations include:

  • Use of mild detergents or lipid nanodiscs for extraction and purification

  • Addition of stabilizing agents during purification

  • Optimization of expression temperature and induction conditions

  • Incorporation of affinity tags that minimally interfere with protein folding and function

What techniques are used for functional characterization of recombinant arnC?

Functional characterization of arnC can be approached using several complementary techniques:

  • Enzymatic Activity Assays: Measuring the transfer of L-Ara4FN from UDP-L-Ara4FN to UndP using:

    • Radiolabeled substrate tracking

    • HPLC analysis of reaction products

    • Mass spectrometry to detect modified UndP

  • Binding Studies:

    • Microscale thermophoresis (MST) has been used to demonstrate that Mn²⁺ enables higher affinity binding of UDP to arnC

    • Isothermal titration calorimetry (ITC) for thermodynamic characterization of substrate binding

  • Structural Studies:

    • Cryo-electron microscopy of the protein embedded in lipid nanodiscs

    • X-ray crystallography (challenging for membrane proteins but potentially informative)

  • Computational Approaches:

    • Molecular dynamics simulations to investigate dynamic aspects of enzyme-substrate interactions

    • Homology modeling for prediction of species-specific structural features

What is the proposed catalytic mechanism of arnC and how does it compare to other glycosyltransferases?

The catalytic mechanism of arnC has been elucidated through a combination of structural studies and molecular simulations . The proposed mechanism involves several key steps:

  • Initial Binding: UndP threads through the JM helices and is coordinated in position P1 (the "standby" position).

  • Donor Substrate Binding: UDP-L-Ara4FN binds to the GT-A domain, triggering a conformational rearrangement in the flexible β7-JM2 loop.

  • Acceptor Repositioning: This conformational change allows UndP to move to position P2 (the "catalysis position").

  • Activation and Nucleophilic Attack: The first aspartate of the DXD motif functions as a catalytic base to abstract a proton from UndP, activating it to perform a nucleophilic attack on the C1 carbon of the L-Ara4FN sugar.

  • Product Formation and Release: After reaction completion, the newly formed product forces UndP to backtrack into a "product position," facilitating its release back to the membrane.

This mechanism follows an SN2-like substitution reaction typical of GT-A fold glycosyltransferases but with specific adaptations for membrane-associated substrates. Unlike many glycosyltransferases that modify soluble acceptors, arnC's mechanism includes specialized features for handling the lipid acceptor UndP, such as the threading through juxtamembrane helices and the two-position coordination system within the GT-A domain .

How do conformational dynamics influence arnC catalytic efficiency?

Comparative analysis of apo and UDP-bound conformations of arnC reveals significant conformational changes that are critical for catalytic function :

Conformational StateKey FeaturesFunctional Significance
Apo stateFlexible GT-A domain relative to JM helicesAllows initial threading and positioning of UndP in P1
UDP-bound stateClamshell-like closure bringing GT-A closer to JM helicesEnables repositioning of UndP from P1 to P2 for catalysis
Post-catalysis state (predicted)Partial opening to facilitate product releaseAllows the modified UndP to return to the membrane

The conformational rearrangement in the β7-JM2 loop upon UDP binding is particularly crucial, as it directly influences the positioning of UndP. This dynamic interplay between substrate binding and protein conformation exemplifies an induced-fit model of enzyme catalysis, where binding of one substrate (UDP-L-Ara4FN) creates the optimal environment for reaction with the second substrate (UndP) .

For researchers studying these dynamics, methodological approaches include:

  • Time-resolved cryo-EM to capture intermediate conformational states

  • Hydrogen-deuterium exchange mass spectrometry to identify regions of conformational flexibility

  • Molecular dynamics simulations with enhanced sampling techniques to characterize energy landscapes of conformational transitions

What role do metal ions play in arnC function and how can this be experimentally investigated?

Metal ions, particularly Mn²⁺, play critical roles in the function of arnC and related glycosyltransferases :

  • Substrate Binding: Microscale thermophoresis studies demonstrate that Mn²⁺ significantly enhances the binding affinity of UDP to arnC .

  • Structural Organization: The metal ion coordinates with the DXD motif and phosphate groups of the nucleotide sugar donor, helping to position the substrate correctly for catalysis.

  • Catalytic Assistance: While not directly participating in proton abstraction (which is proposed to be performed by the first aspartate of the DXD motif), the metal ion may stabilize developing negative charges during the transition state.

Experimental approaches to investigate metal ion roles include:

TechniqueInformation ProvidedMethodological Considerations
Metal substitution studiesIdentify which metals support activityTest various divalent cations (Mg²⁺, Ca²⁺, Zn²⁺)
Site-directed mutagenesisConfirm residues involved in metal coordinationFocus on DXD motif and surrounding residues
Spectroscopic methodsCharacterize metal binding environmentEPR or XAS for paramagnetic metals
ITC with and without metalsQuantify contribution to binding thermodynamicsCareful buffer selection to control metal availability
Activity assays with metal chelatorsDetermine metal dependence of catalysisUse EDTA, EGTA with varying affinities

What structural features of arnC could be exploited for the design of inhibitors to combat polymyxin resistance?

Understanding the structural details of arnC provides several promising avenues for inhibitor design to combat polymyxin resistance :

  • Nucleotide Binding Pocket: The UDP-binding site offers an opportunity for competitive inhibitors that mimic the nucleotide portion of the donor substrate.

  • Sugar Donor Site: Compounds that mimic L-Ara4FN but contain modifications that prevent transfer could serve as substrate-competitive inhibitors.

  • Conformational Change Inhibitors: Molecules that stabilize arnC in its apo conformation would prevent the clamshell-like motion necessary for catalysis.

  • UndP Threading Pathway: Compounds designed to block the channel through which UndP threads to reach the catalytic site could prevent substrate access.

  • Catalytic Base Interaction: Inhibitors that interact with the first aspartate of the DXD motif could prevent its function as a catalytic base.

Target SiteInhibitor TypePotential AdvantagesChallenges
UDP binding siteNucleotide analogsWell-defined pocketSelectivity versus host nucleotide-binding proteins
L-Ara4FN binding siteSugar mimeticsPotentially high specificityNeed to overcome polar nature for membrane penetration
Protein-protein interfacesAllosteric inhibitorsNovel mechanism of actionComplex rational design requirements
UndP pathwayLipid-like moleculesUnique target siteBalancing membrane permeability and target specificity

How can mutagenesis studies inform our understanding of arnC substrate specificity?

Targeted mutagenesis studies can provide valuable insights into the determinants of substrate specificity in arnC. Based on structural and simulation data , several key residues would be prime candidates for mutagenesis:

  • Arginine Residues R128 and R137: These residues coordinate the phosphate of UndP in position P1. Mutations (e.g., R→A, R→K) could reveal their importance for initial substrate positioning.

  • First Aspartate of the DXD Motif: Proposed to function as the catalytic base. Mutations (e.g., D→N, D→E) would test its role in the catalytic mechanism.

  • Residues in the β7-JM2 Loop: This region undergoes conformational changes upon UDP binding. Alanine scanning or insertions/deletions could identify key residues for the conformational transition.

  • Juxtamembrane Helices: Mutations in residues lining the UndP threading pathway could alter substrate selectivity or catalytic efficiency.

Methodologically, mutagenesis studies should combine:

ApproachPurposeExpected Outcome
Steady-state kinetic analysisQuantify effects on catalytic parametersChanges in Km, kcat for each substrate
Binding studies (MST, ITC)Measure effects on substrate affinityAltered binding constants
Bacterial resistance assaysConnect biochemical changes to phenotypeChanges in MIC values for polymyxins
Structural studies of mutantsVisualize effects on protein conformationAltered conformational states
Molecular dynamics simulationsPredict and interpret mutation effectsChanges in substrate positioning and dynamics

What are the species-specific variations in arnC structure and function across different Gram-negative pathogens?

While the search results focus primarily on arnC from S. enterica , comparative analysis across different bacterial species is crucial for understanding the evolution and adaptability of this resistance mechanism. Species-specific variations may exist in:

  • Primary Sequence: Variations in key catalytic and substrate-binding residues could affect enzyme efficiency and substrate specificity.

  • Expression Regulation: Differences in how arnC expression is regulated in response to environmental stimuli (e.g., low Mg²⁺, presence of antimicrobial peptides).

  • Structural Features: Species-specific variations in the juxtamembrane helices or flexible loops could influence substrate binding and catalytic efficiency.

  • Interaction with Other Arn Pathway Proteins: Differences in protein-protein interactions within the aminoarabinose modification pathway.

Methodological approaches for comparative studies:

MethodApplicationExpected Insights
Comparative genomicsIdentify conserved and variable regionsEvolutionary conservation of functional domains
Heterologous expressionExpress arnC from different speciesFunctional differences in activity and substrate specificity
Cross-species complementationExpress foreign arnC in knockout strainsAbility of homologs to restore polymyxin resistance
Homology modelingPredict structures of uncharacterized homologsStructural variations that may affect function
Chimeric proteinsSwap domains between speciesIdentify domains responsible for species-specific properties

How does the integration of computational and experimental approaches enhance our understanding of arnC function?

The integration of computational and experimental methods has been instrumental in elucidating the structure and function of arnC . This multi-modal approach provides several advantages:

  • Complementary Strengths:

    • Experimental methods (cryo-EM) provide static structural snapshots with atomic detail

    • Computational methods (molecular dynamics) add dynamic information about conformational changes and transient interactions

  • Hypothesis Generation and Testing:

    • Simulations can predict substrate binding modes and conformational changes

    • Experimental methods can validate these predictions

  • Accessing Challenging Information:

    • Simulations can reveal transient states difficult to capture experimentally

    • Experiments provide ground truth for refining computational models

Integration ApproachImplementationResearch Value
Structure-guided simulationsUse cryo-EM structures as starting points for MDPredict dynamics of substrate binding and conformational changes
Simulation-guided mutagenesisIdentify key residues from simulations for experimental testingFocused experimental design with higher success probability
Experimental validation of computational predictionsTest predictions about substrate positioning experimentallyRefinement of computational models
Iterative model improvementUse experimental data to refine force fields and simulation parametersIncreasingly accurate computational predictions

What techniques enable the study of arnC in its native membrane environment?

Studying integral membrane proteins like arnC in their native environment presents unique challenges that require specialized techniques :

  • Lipid Nanodisc Technology:

    • Successfully used for structural determination of arnC by cryo-EM

    • Provides a native-like lipid bilayer environment while maintaining protein solubility

    • Allows control over lipid composition to mimic bacterial inner membrane

  • Native Mass Spectrometry:

    • Enables analysis of intact membrane protein complexes with bound lipids

    • Can provide insights into protein-lipid interactions and oligomeric state

  • Solid-State NMR:

    • Offers atomic-level information about protein structure and dynamics in a membrane environment

    • Can provide orientation information relative to the membrane plane

  • Fluorescence-Based Techniques:

    • FRET studies can monitor conformational changes in response to substrate binding

    • Single-molecule approaches can reveal population heterogeneity and rare states

TechniqueKey Information ProvidedTechnical Considerations
Cryo-EM with nanodiscsHigh-resolution structural informationRequires optimization of nanodisc size and lipid composition
Hydrogen-deuterium exchange MSIdentifies regions of conformational flexibilityModified protocols needed for membrane proteins
Solid-state NMRDetailed structural information in membraneRequires isotopic labeling and specialized equipment
Electron paramagnetic resonanceDistance measurements and dynamicsRequires site-specific spin labeling
Surface plasmon resonanceBinding kinetics for substrates and inhibitorsNeed for stable immobilization in membrane-mimetic environment

What are the current limitations in arnC research and how might they be addressed?

Despite significant progress in understanding arnC structure and function , several research challenges remain:

  • Structural Resolution Limitations:

    • Current cryo-EM structures provide valuable insights but higher resolution would reveal additional details about substrate coordination and catalytic mechanism

    • Methodological improvements could include better grid preparation techniques, enhanced image processing algorithms, and physical improvements to specimen preparation

  • Complete Catalytic Cycle Characterization:

    • Current models are based on apo and UDP-bound states, but structures with both substrates or product-bound states are lacking

    • Time-resolved structural studies or trapped reaction intermediates could provide a more complete picture

  • Species-Specific Variations:

    • Limited structural information across different bacterial species restricts our understanding of evolutionary adaptations

    • Comparative structural biology across clinically relevant pathogens would address this gap

  • In Vivo Relevance:

    • Connecting in vitro biochemical findings to in vivo resistance mechanisms remains challenging

    • Development of cellular assays that can monitor arnC activity in living bacteria would bridge this gap

ChallengePotential SolutionExpected Impact
Limited structural resolutionAdvanced cryo-EM methods, crystallization of stable constructsMore detailed catalytic mechanism
Missing catalytic intermediatesSubstrate/product analogs, time-resolved methodsComplete understanding of reaction pathway
Species-specific variationsParallel structural studies across pathogensInsights into evolutionary adaptations
In vivo relevanceDevelopment of cellular activity assaysConnection between biochemistry and resistance

How might inhibition of arnC be integrated into broader antimicrobial strategies?

Targeting arnC represents a promising approach to combat polymyxin resistance, but its integration into broader antimicrobial strategies requires careful consideration:

  • Combination Therapy Approaches:

    • ArnC inhibitors could potentially restore sensitivity to polymyxins in resistant strains

    • Synergistic effects might be achieved with other agents targeting different aspects of bacterial outer membrane structure

  • Resistance Mechanism Considerations:

    • Bacteria often possess multiple resistance mechanisms, so targeting arnC alone might not fully restore antimicrobial susceptibility

    • Understanding the interplay between different resistance mechanisms is crucial

  • Species-Specific Targeting:

    • Different Gram-negative species may rely to varying degrees on the Arn pathway for polymyxin resistance

    • Species-specific inhibitor design might be necessary for optimal efficacy

  • Resistance Development:

    • Bacteria might develop resistance to arnC inhibitors through mutations or alternative pathways

    • Structural understanding could help predict and counter resistance development

Methodological approaches for developing and evaluating arnC inhibitors within broader antimicrobial strategies include:

ApproachPurposeConsiderations
Checkerboard assaysEvaluate synergy between arnC inhibitors and antimicrobialsTest across multiple bacterial species and resistance backgrounds
Time-kill studiesAssess bactericidal activity of combination approachesDetermine optimal timing and concentration relationships
Resistance development studiesEvaluate propensity for resistance developmentSerial passage experiments with and without inhibitor present
Animal infection modelsTest efficacy in physiologically relevant contextsConsider pharmacokinetic/pharmacodynamic relationships
Structural studies of resistant mutantsUnderstand mechanisms of inhibitor resistanceInform next-generation inhibitor design

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.