Recombinant Klebsiella pneumoniae UPF0208 membrane protein KPK_1462 (KPK_1462)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
KPK_1462; UPF0208 membrane protein KPK_1462
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Klebsiella pneumoniae (strain 342)
Target Names
KPK_1462
Target Protein Sequence
MSTPEKRPVSFFSLFNRGQHYAKTWPLDKRLAPVFIENRIIRATRYAIRIMPPIAIFTLC WQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPSILNWFYEVRGKLQEAGQAL APVEGKPDYQALADTLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links

KEGG: kpe:KPK_1462

Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the primary structural characteristics of KPK_1462 protein?

KPK_1462 is a 151-amino acid membrane protein with multiple predicted transmembrane domains, characteristic of proteins that integrate into lipid bilayers. The amino acid composition suggests several hydrophobic regions that likely form membrane-spanning helices, interspersed with hydrophilic loops that extend into either the cytoplasm or periplasm.

Analysis of the primary sequence reveals:

  • Molecular weight: Approximately 17 kDa (excluding the His-tag)

  • Hydrophobic regions: Multiple transmembrane-spanning domains

  • N-terminal His-tag: Added during recombinant expression for purification purposes

  • Secondary structure prediction: Predominantly alpha-helical in the transmembrane regions

The protein shares sequence homology with other UPF0208 family proteins, including KPN78578_26420 (UniProt ID: A6TBY2), which has an identical amino acid sequence despite being from a different strain of Klebsiella pneumoniae .

How does the lipid environment affect the stability and function of UPF0208 membrane proteins?

The lipid bilayer significantly impacts both the stability and functional response of membrane proteins like KPK_1462. Research indicates that lipids do not merely provide a hydrophobic environment but actively modulate protein behavior. Two critical factors in this relationship are:

  • Hydrophobic thickness: The match between the hydrophobic thickness of the lipid bilayer and the protein's transmembrane domains is essential for optimal stability. Hydrophobic mismatch can cause protein distortion and reduced stability .

  • Amphiphile-amphiphile packing strength: The packing interactions between lipids surrounding the protein influence how well the protein is stabilized within the membrane .

Lipid solvation enhances protein stability by:

  • Facilitating proper residue burial in the protein interior

  • Strengthening the cooperative network of the protein structure

  • Promoting the propagation of local structural perturbations

  • Influencing how the protein responds to external stimuli

This means that when designing experiments with KPK_1462, researchers should carefully consider the lipid composition used for protein reconstitution, as it will significantly impact experimental outcomes.

What are the optimal conditions for recombinant expression of KPK_1462 protein?

The optimal expression of recombinant KPK_1462 protein involves several critical parameters:

Expression System:

  • Host: E. coli (typically BL21(DE3) or similar strains)

  • Vector: pET-based vectors with N-terminal His-tag

  • Promoter: T7 or tac promoters for controlled induction

Expression Conditions:

  • Induction: 0.1-0.5 mM IPTG at OD600 0.6-0.8

  • Temperature: 16-18°C post-induction (reduced temperature mitigates inclusion body formation)

  • Duration: 16-20 hours for optimal yield

  • Media: Enriched media such as 2xYT or Terrific Broth supplemented with appropriate antibiotics

Critical Considerations:

  • Addition of membrane protein expression enhancers (e.g., 0.5-1% glucose pre-induction)

  • Potential toxicity monitoring during expression

  • Cell density optimization to balance yield and proper folding

For membrane proteins like KPK_1462, lower expression temperatures reduce aggregation and improve folding efficiency. The expression system should incorporate a fusion tag (typically His-tag) for subsequent purification steps .

What purification strategies yield the highest purity and activity of the recombinant KPK_1462 protein?

A multi-step purification strategy is recommended for obtaining high-purity, active KPK_1462:

Step 1: Membrane Preparation

  • Cell lysis: Mechanical disruption (French press/sonication) in a buffer containing protease inhibitors

  • Membrane isolation: Ultracentrifugation (typically 100,000×g for 1 hour)

  • Membrane solubilization: Detergent selection is critical (common options include DDM, LMNG, or OG at 1-2% w/v)

Step 2: Immobilized Metal Affinity Chromatography (IMAC)

  • Column: Ni-NTA or similar

  • Buffer: Tris/PBS-based with 0.05-0.1% detergent

  • Elution: Imidazole gradient (50-300 mM)

Step 3: Size Exclusion Chromatography

  • Further separation based on size to remove aggregates and contaminants

  • Buffer: Tris/PBS-based with reduced detergent concentration

Step 4: Assessment

  • Purity: >90% as determined by SDS-PAGE

  • Activity: Function-specific assays

Storage Considerations:

  • Storage buffer: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Aliquoting is necessary for multiple use

  • Storage at -20°C/-80°C, avoiding repeated freeze-thaw cycles

  • For working solutions, store at 4°C for up to one week

How can researchers effectively reconstitute KPK_1462 into liposomes for functional studies?

Reconstitution of KPK_1462 into liposomes requires careful attention to both lipid composition and methodology:

Liposome Preparation:

  • Lipid Selection: A mixture of phospholipids (POPC, POPE, POPG) with optional cholesterol (10-20%) to mimic bacterial membrane composition

  • Lipid Film Formation: Dissolve lipids in chloroform, dry under nitrogen, and remove residual solvent under vacuum

  • Hydration: Rehydrate with buffer to form multilamellar vesicles

  • Sizing: Extrusion through polycarbonate filters (100-200 nm) to form unilamellar vesicles

Protein Incorporation Methods:

  • Detergent-Mediated Reconstitution:

    • Mix purified protein (in detergent) with preformed liposomes

    • Gradually remove detergent using Bio-Beads or dialysis

    • Typical protein:lipid ratio: 1:100 to 1:1000 (w/w)

  • Direct Incorporation:

    • Add protein during liposome formation

    • Particularly useful for highly hydrophobic proteins

Quality Control Assessments:

  • Protein orientation: Protease protection assays

  • Incorporation efficiency: Density gradient centrifugation

  • Size and homogeneity: Dynamic light scattering

  • Functional integrity: Activity assays specific to membrane transport or signaling

Since research indicates that lipid environments significantly affect membrane protein stability and function, optimizing the lipid composition is crucial for obtaining functionally relevant results .

How does the cooperative network of KPK_1462 respond to different lipid environments?

The cooperative network of membrane proteins like KPK_1462 exhibits significant responsiveness to variations in the surrounding lipid environment. This relationship can be analyzed through several experimental approaches:

Lipid Environment Variations:

Lipid ParameterExperimental RangeEffects on KPK_1462
Acyl chain lengthC14-C22Affects hydrophobic matching with transmembrane domains
Headgroup compositionPC, PE, PG, PSInfluences surface charge interactions
Cholesterol content0-40%Modulates membrane fluidity and thickness
Curvature stressVaried PE:PC ratioImpacts protein conformational flexibility

Research indicates that lipid solvation enhances stability by facilitating residue burial in the protein interior and strengthens the cooperative network by promoting the propagation of local structural perturbations. When studying KPK_1462, researchers should examine how different lipid compositions affect:

  • Thermal stability (Tm values from thermal denaturation experiments)

  • Conformational changes (monitored via spectroscopic methods)

  • Functional parameters (substrate binding or transport kinetics)

  • Resistance to denaturants (chemical denaturation profiles)

These investigations would reveal how the lipid environment modulates not only KPK_1462's stability but also its response to external stimuli, providing insights into the protein's functional mechanism in different cellular contexts .

What are the key differences between KPK_1462 and the related UPF0208 membrane protein KPN78578_26420?

Although KPK_1462 (UniProt ID: B5XNU5) and KPN78578_26420 (UniProt ID: A6TBY2) share identical amino acid sequences (151 amino acids), they are derived from different strains of Klebsiella pneumoniae, which may lead to subtle but significant differences in their native environments and potential functions:

Comparison Table:

FeatureKPK_1462KPN78578_26420
Amino Acid SequenceMSTPEKRPVSFFSLFNRGQHYAKTWPLDKRLAPVFIENRIIRATRYAIRIMPPIAIFTLCWQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPSILNWFYEVRGKLQEAGQALAPVEGKPDYQALADTLKRAFKQLDKTFLDDLIdentical to KPK_1462
Source OrganismKlebsiella pneumoniaeKlebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
UniProt IDB5XNU5A6TBY2
Gene NameKPK_1462KPN78578_26420
FunctionUncharacterizedUncharacterized

Despite their sequence identity, these proteins may exhibit different behaviors due to:

  • Strain-specific post-translational modifications: Different bacterial strains may process the same protein differently

  • Genomic context: The surrounding genes may differ, suggesting different functional associations

  • Expression patterns: The regulation of expression may vary between strains

  • Protein-protein interactions: Strain-specific interaction partners may affect function

Researchers investigating these proteins should consider these potential differences when designing comparative studies or interpreting results from different experimental systems .

What structural prediction methods are most effective for analyzing the transmembrane domains of KPK_1462?

For predicting and analyzing the transmembrane domains of KPK_1462, researchers should employ a multi-method approach:

Computational Methods Comparison:

Prediction MethodStrengthsLimitationsApplication to KPK_1462
TMHMMAccurate for alpha-helical TMDsLimited for beta-barrel predictionsIdentifies potential transmembrane helices
MEMSAT-SVMIncorporates evolutionary informationRequires high-quality alignmentsPredicts topology with higher accuracy
AlphaFold2State-of-the-art 3D structure predictionLess reliable in membrane environmentsProvides full structural model
PhobiusCombines signal peptide and TMD predictionLess accurate for complex topologiesUseful for N-terminal analysis
TOPCONSConsensus approach from multiple methodsMay average out unique predictionsProvides consensus topology prediction

Experimental Validation Approaches:

  • Cysteine scanning mutagenesis: Systematically replacing residues with cysteine and testing accessibility

  • Epitope insertion: Inserting epitope tags at predicted loops and testing accessibility

  • Protease protection assays: Determining which regions are protected by the membrane

  • Hydrogen-deuterium exchange mass spectrometry: Identifying solvent-accessible regions

When applying these methods to KPK_1462, researchers should focus on:

  • The predicted hydrophobic transmembrane regions

  • The orientation of the N-terminal His-tag (likely cytoplasmic)

  • Potential functional residues at the membrane-water interface

  • Possible conformational changes in different lipid environments

A combined computational and experimental approach yields the most reliable structural information for membrane proteins like KPK_1462, enabling more informed functional studies and hypothesis generation .

What experimental approaches can determine the functional role of KPK_1462 in Klebsiella pneumoniae?

Determining the functional role of the uncharacterized KPK_1462 protein requires a multi-faceted experimental strategy:

Genetic Approaches:

  • Gene knockout/knockdown: Constructing deletion mutants and assessing phenotypic changes

  • Overexpression studies: Examining effects of increased protein levels

  • Complementation assays: Restoring function in deletion mutants

  • Site-directed mutagenesis: Targeting conserved residues to identify functional domains

Interactome Analysis:

  • Pull-down assays: Identifying protein interaction partners using the His-tagged protein

  • Bacterial two-hybrid systems: Screening for protein-protein interactions

  • Crosslinking studies: Capturing transient interactions in native membranes

  • Co-immunoprecipitation: Confirming interactions in cellular contexts

Localization and Expression Studies:

  • Fluorescent protein fusion: Tracking subcellular localization

  • Immunogold electron microscopy: High-resolution localization studies

  • qRT-PCR: Analyzing expression under different conditions

  • Western blotting: Quantifying protein levels during stress responses

Functional Assays:

  • Transport assays: Testing substrate transport across membranes

  • Electrophysiology: Measuring ion channel activity if applicable

  • Lipid interaction studies: Determining specific lipid binding preferences

  • Bacterial growth under stress: Identifying conditions where the protein becomes essential

These approaches should be conducted systematically, starting with genetic and localization studies to establish basic functional context, followed by more specific biochemical assays based on initial findings. The UPF0208 family's uncharacterized nature presents significant opportunities for novel functional discoveries .

How do different detergents affect the stability and activity of purified KPK_1462 protein?

Detergent selection significantly impacts the stability and activity of membrane proteins like KPK_1462. A comparative analysis reveals important considerations:

Detergent Comparison Table:

DetergentCMC (mM)Micelle Size (kDa)Advantages for KPK_1462Limitations
DDM (n-Dodecyl-β-D-maltoside)0.1770Gentle, maintains stabilityLarge micelles, may interfere with some assays
LMNG (Lauryl maltose neopentyl glycol)0.0190Enhanced stability, lower CMCExpensive, difficult to remove
OG (n-Octyl-β-D-glucoside)2325Easily dialyzable, small micellesHarsher, potential denaturation
DM (n-Decyl-β-D-maltoside)1.840Intermediate propertiesModerate stability
Digitonin0.570Natural detergent, gentleHeterogeneous, batch variation

Stability Assessment Methods:

  • Thermal stability assays: Monitoring protein unfolding at increasing temperatures

  • Time-course activity measurements: Tracking activity retention over time

  • Circular dichroism: Monitoring secondary structure retention

  • Size-exclusion chromatography: Assessing aggregation and oligomeric state

  • For structural studies: LMNG or DDM

  • For functional reconstitution: OG (easier to remove during reconstitution)

  • For mass spectrometry: C12E8 or LDAO (lower background)

When transitioning from detergent micelles to lipid environments for functional studies, researchers should consider using lipid nanodiscs or amphipols as intermediate stabilizing systems to maintain protein integrity .

What computational approaches can predict potential binding partners or substrates for KPK_1462?

Identifying potential binding partners or substrates for an uncharacterized membrane protein like KPK_1462 can be approached through various computational methods:

Sequence-Based Methods:

  • Motif analysis: Identifying conserved binding motifs in the protein sequence

  • Co-evolution analysis: Detecting co-evolving residues that may indicate interaction sites

  • Homology-based annotation: Inferring function from characterized homologs

  • Genomic context analysis: Examining neighboring genes for functional associations

Structure-Based Approaches:

  • Molecular docking: Virtual screening of potential ligands against predicted binding pockets

  • Binding site prediction: Identifying cavities and pockets that may accommodate substrates

  • Molecular dynamics simulations: Exploring conformational flexibility and potential binding events

  • Electrostatic surface mapping: Identifying regions favorable for specific types of interactions

Network-Based Predictions:

  • Protein-protein interaction networks: Inferring interactions based on known network properties

  • Gene co-expression analysis: Identifying genes with similar expression patterns

  • Phylogenetic profiling: Finding proteins with similar evolutionary patterns

  • Text mining: Extracting potential associations from scientific literature

Implementation Strategy:

For KPK_1462, a hierarchical approach is recommended:

  • Start with sequence-based methods to generate initial hypotheses

  • Refine predictions using structural models and docking studies

  • Prioritize candidates based on network analysis

  • Experimentally validate top predictions using binding assays

This comprehensive computational strategy can significantly narrow down the list of potential binding partners or substrates, guiding subsequent experimental validation and functional characterization of this uncharacterized membrane protein .

How might KPK_1462 contribute to antimicrobial resistance mechanisms in Klebsiella pneumoniae?

As Klebsiella pneumoniae is a significant pathogen associated with hospital-acquired infections and increasing antimicrobial resistance, understanding the potential role of KPK_1462 in resistance mechanisms is valuable:

Potential Contributions to Resistance:

  • Membrane permeability modulation: KPK_1462 may alter membrane properties, affecting antibiotic penetration

    • Changes in lipid organization could create permeability barriers

    • Altered membrane fluidity might impact passive diffusion of antibiotics

  • Efflux pump cooperation: While not an efflux pump itself, KPK_1462 might:

    • Act as an accessory protein for established efflux systems

    • Stabilize multi-protein efflux complexes

    • Sense antibiotic presence and trigger efflux system expression

  • Stress response participation: KPK_1462 could contribute to bacterial survival under antibiotic stress by:

    • Maintaining membrane integrity during envelope stress

    • Participating in stress signaling cascades

    • Contributing to biofilm formation under antibiotic pressure

  • Metabolic adaptation: The protein might facilitate metabolic changes that promote antibiotic tolerance:

    • Modifying energy metabolism during antibiotic exposure

    • Facilitating nutrient acquisition under stress conditions

    • Contributing to persister cell formation

Research Approaches:

  • Compare expression levels in resistant versus susceptible isolates

  • Examine knockout effects on minimum inhibitory concentrations

  • Analyze protein-protein interactions with known resistance determinants

  • Investigate structural changes in the membrane upon antibiotic exposure

Understanding KPK_1462's potential role in resistance mechanisms could provide insights for developing novel antimicrobial strategies targeting membrane proteins in Klebsiella pneumoniae .

What novel analytical techniques are emerging for studying membrane protein dynamics that could be applied to KPK_1462?

Emerging analytical techniques for studying membrane protein dynamics offer new opportunities for characterizing KPK_1462's behavior:

Advanced Spectroscopic Methods:

  • Single-molecule FRET (smFRET): Measuring distances between labeled residues during conformational changes

    • Application to KPK_1462: Monitoring dynamic changes in transmembrane domain arrangements

    • Advantage: Captures transient states invisible to ensemble methods

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Identifying solvent-accessible regions and conformational changes

    • Application to KPK_1462: Mapping exposed regions in different lipid environments

    • Advantage: Requires smaller amounts of protein than structural methods

Cryo-EM Advances:

  • Time-resolved cryo-EM: Capturing proteins in different functional states

    • Application to KPK_1462: Visualizing structural changes during potential transport cycles

    • Advantage: Higher resolution than traditional dynamics methods

  • Cryo-electron tomography: Studying proteins in near-native membrane environments

    • Application to KPK_1462: Examining organization within membrane context

    • Advantage: Provides cellular context for functional understanding

Computational Methods:

  • Coarse-grained molecular dynamics: Simulating longer timescales relevant to membrane protein function

    • Application to KPK_1462: Modeling interactions with lipids over microsecond timescales

    • Advantage: Accesses timescales relevant to biological function

  • AlphaFold2 and RoseTTAFold: Predicting protein structures with unprecedented accuracy

    • Application to KPK_1462: Generating reliable structural models for functional hypothesis generation

    • Advantage: Provides structural insights when experimental structures are unavailable

Membrane Mimetic Systems:

  • Lipid nanodiscs: Providing defined, native-like membrane environments

    • Application to KPK_1462: Studying function in controlled lipid compositions

    • Advantage: Maintains native lipid bilayer while enabling solution-phase techniques

  • Cell-free expression in membrane mimetics: Direct expression into membrane environments

    • Application to KPK_1462: Avoiding detergent extraction and reconstitution steps

    • Advantage: Potentially better preservation of native structure and function

These emerging techniques, applied synergistically, could provide unprecedented insights into KPK_1462's dynamics, interactions, and functional mechanisms .

How might comparative analysis of UPF0208 family proteins across different bacterial species inform functional hypotheses for KPK_1462?

Comparative analysis of UPF0208 family proteins across bacterial species can yield valuable insights into KPK_1462's potential functions:

Evolutionary Conservation Analysis:

FeatureConservation LevelFunctional Implication
Transmembrane domainsHighly conservedEssential structural role
Cytoplasmic loopsVariableSpecies-specific interactions
Key charged residuesConserved in specific cladesPotential functional motifs
N-terminal regionModerately conservedPossible regulatory domain
C-terminal domainHighly conservedCritical for core function

Taxonomic Distribution Patterns:

  • Universal presence: Functions essential to bacterial physiology

  • Pathogen-specific: Potential roles in virulence or host adaptation

  • Environment-specific: Adaptations to particular ecological niches

  • Co-occurrence with specific pathways: Functional association with those pathways

Genomic Context Analysis:

  • Conserved gene neighborhoods: Suggest functional relationships

  • Operon structures: Indicate coordinated expression and related functions

  • Horizontal gene transfer patterns: Reveal adaptive significance

  • Regulatory element conservation: Provides clues about expression control

Application to KPK_1462:

  • Identify highly conserved residues as targets for mutagenesis studies

  • Map variations in protein length or domain organization across species

  • Correlate presence/absence with specific bacterial phenotypes

  • Examine expression patterns in different bacteria under various conditions

This comparative approach can generate testable hypotheses about KPK_1462's function by leveraging evolutionary information across the bacterial kingdom. If certain features are conserved only in pathogenic bacteria, for instance, this might suggest roles in virulence or host interaction, while conservation across diverse bacteria might indicate fundamental cellular functions .

What are the major challenges in crystallizing membrane proteins like KPK_1462 for structural studies?

Membrane proteins like KPK_1462 present significant crystallization challenges, requiring specialized approaches:

Key Challenges and Solutions:

  • Detergent Micelle Management:

    • Challenge: Detergent micelles create large, heterogeneous hydrophobic surfaces

    • Solutions:

      • Screening multiple detergent types (DDM, LMNG, OG)

      • Utilizing detergent mixtures for optimal micelle properties

      • Employing lipidic cubic phase (LCP) crystallization methods

  • Conformational Heterogeneity:

    • Challenge: Membrane proteins often adopt multiple conformational states

    • Solutions:

      • Stabilizing mutations to lock specific conformations

      • Co-crystallization with stabilizing ligands or antibody fragments

      • Using nanobodies to reduce conformational freedom

  • Limited Hydrophilic Surface Area:

    • Challenge: Insufficient protein-protein contacts for crystal lattice formation

    • Solutions:

      • Fusion protein approaches (T4 lysozyme, BRIL insertions)

      • Antibody fragment (Fab, scFv) co-crystallization

      • Engineering additional polar residues at terminal regions

  • Protein Stability Issues:

    • Challenge: Instability outside native membrane environment

    • Solutions:

      • Thermostabilizing mutations

      • Cholesterol or specific lipid addition

      • Utilizing more stable homologs from thermophilic organisms

Crystallization Strategy for KPK_1462:

ApproachSpecific ImplementationSuccess Factors
Vapor diffusionSitting drop with low detergent concentrationControlled detergent:protein ratio
LCP methodMonoolein matrix with specific additivesMimics native membrane environment
Bicelle methodDMPC/CHAPSO bicelles with proteinIntermediate between detergent and lipid systems
In meso approachReconstitution in lipidic mesophasesSupports native-like conformation

Additionally, researchers might consider alternative structural biology approaches:

  • Cryo-EM for single-particle analysis (may require larger constructs)

  • Solid-state NMR for specific structural questions

  • X-ray free electron laser (XFEL) for microcrystals

These specialized approaches address the unique challenges of membrane protein crystallization and can be adapted for structural studies of KPK_1462 .

How can researchers overcome expression and purification bottlenecks when working with KPK_1462?

Membrane proteins like KPK_1462 present numerous expression and purification challenges that require specialized strategies:

Expression Bottlenecks and Solutions:

  • Low Expression Levels:

    • Challenge: Membrane proteins often express poorly in heterologous systems

    • Solutions:

      • Codon optimization for expression host

      • Use of specialized expression strains (C41/C43, Lemo21)

      • Fusion with soluble partners (MBP, SUMO) at N-terminus

      • Inclusion of molecular chaperones as co-expression partners

  • Toxicity to Host Cells:

    • Challenge: Overexpression can disrupt host cell membrane integrity

    • Solutions:

      • Tight control of expression using tunable promoters

      • Lower culture temperatures (16-20°C) during induction

      • Use of specialized "membrane protein-friendly" strains

      • Glucose repression pre-induction to prevent leaky expression

Purification Bottlenecks and Solutions:

  • Detergent Selection Complexity:

    • Challenge: Finding detergents that extract efficiently without denaturation

    • Solutions:

      • Systematic screening of detergent panels

      • Gradient extraction approaches

      • Use of detergent mixtures for efficient solubilization

      • Implementation of native nanodiscs for detergent-free extraction

  • Protein Instability During Purification:

    • Challenge: Loss of structural integrity during multiple purification steps

    • Solutions:

      • Addition of stabilizing ligands throughout purification

      • Inclusion of specific lipids in purification buffers

      • Optimization of buffer components (pH, salt, glycerol)

      • Minimizing purification steps and time

Optimization Strategy Table:

StageParameterOptimization ApproachMonitoring Method
ExpressionInduction timingTest OD600 range 0.4-1.0Western blot/GFP fusion
ExpressionIPTG concentrationTitration (0.01-1.0 mM)SDS-PAGE/activity
ExtractionDetergent typeScreen multiple classesExtraction efficiency assay
ExtractionDetergent concentrationTest 1-5× CMC rangeSolubilization efficiency
PurificationBuffer compositionFactorial screening designProtein stability assays
PurificationChromatography sequenceCompare various approachesYield and purity assessment

Implementation of these strategies should follow an iterative optimization process, where each step is evaluated for KPK_1462-specific requirements. Small-scale expression and purification trials should precede large-scale production to identify optimal conditions .

What quality control methods are essential for ensuring the structural and functional integrity of purified KPK_1462?

Ensuring the structural and functional integrity of purified KPK_1462 requires comprehensive quality control methods:

Structural Integrity Assessment:

  • Size and Homogeneity Analysis:

    • Analytical size exclusion chromatography (SEC): Evaluating oligomeric state and aggregation

    • Dynamic light scattering (DLS): Measuring size distribution and polydispersity

    • Multi-angle light scattering (MALS): Determining absolute molecular weight

    • Native PAGE: Assessing native conformation and oligomerization

  • Thermal and Chemical Stability:

    • Differential scanning fluorimetry (DSF): Measuring thermal unfolding transitions

    • Circular dichroism (CD): Monitoring secondary structure content and stability

    • Fluorescence spectroscopy: Tracking tertiary structure changes

    • Limited proteolysis: Identifying flexible or unfolded regions

Functional Integrity Assessment:

  • Binding Assays:

    • Isothermal titration calorimetry (ITC): Quantifying binding parameters

    • Surface plasmon resonance (SPR): Measuring real-time binding kinetics

    • Microscale thermophoresis (MST): Detecting molecular interactions in solution

    • Fluorescence anisotropy: Monitoring ligand binding

  • Activity Measurements:

    • Transport assays: Using liposomes or proteoliposomes

    • ATPase activity (if applicable): Measuring ATP hydrolysis rates

    • Spectroscopic assays: Monitoring conformational changes upon substrate addition

    • Electrophysiology: Recording channel activity in reconstituted systems

Quality Control Workflow for KPK_1462:

StageMethodsAcceptance Criteria
Post-extractionSDS-PAGE, Western blot>90% purity, correct MW, immunoreactivity
Post-purificationSEC-MALS, DLSMonodisperse population, expected MW, <10% aggregation
Structural assessmentCD, fluorescenceNative-like secondary/tertiary structure
Functional assessmentBinding/activity assaysSpecific activity within expected range
Long-term stabilityAccelerated stability studiesRetention of >80% activity after storage

The implementation of these quality control methods ensures that only properly folded, homogeneous, and functionally competent KPK_1462 preparations are used for subsequent experiments, significantly improving experimental reproducibility and reliability .

What are the most promising research directions for elucidating the function of UPF0208 family proteins like KPK_1462?

The uncharacterized nature of UPF0208 family proteins like KPK_1462 presents exciting opportunities for novel discoveries. Several promising research directions emerge:

  • Systems Biology Approaches:

    • Comprehensive phenotypic analysis of knockout strains under diverse conditions

    • Integration of transcriptomic, proteomic, and metabolomic data to place KPK_1462 in cellular pathways

    • Network analysis to identify functional associations and regulatory relationships

    • Synthetic genetic array analysis to map genetic interactions

  • Structural Biology Integration:

    • Determination of high-resolution structures in different conformational states

    • Molecular dynamics simulations to explore conformational landscapes

    • Structure-guided mutagenesis to test functional hypotheses

    • Comparative structural analysis across bacterial species

  • Environmental Response Characterization:

    • Examination of expression and localization under various stress conditions

    • Investigation of potential roles in antimicrobial resistance mechanisms

    • Analysis of behavior under host-relevant conditions

    • Assessment of contributions to biofilm formation and maintenance

  • Protein-Lipid Interaction Studies:

    • Mapping specific lipid binding sites and preferences

    • Investigating how lipid composition affects protein function

    • Examining potential roles in membrane organization or microdomain formation

    • Exploring lipid-dependent conformational changes

  • Translational Research Applications:

    • Evaluation as potential antimicrobial targets

    • Development of specific inhibitors for functional studies

    • Assessment of conservation in pathogenic vs. non-pathogenic strains

    • Investigation of potential diagnostic applications

These directions, pursued in parallel with systematic characterization approaches, offer the best chances of elucidating the biological roles of these enigmatic membrane proteins and potentially revealing novel bacterial physiology aspects with clinical relevance .

How might integrating computational and experimental approaches advance understanding of KPK_1462 function?

Integrating computational and experimental approaches creates a powerful framework for deciphering KPK_1462's function:

Integrated Research Workflow:

  • Computational Prediction → Experimental Validation:

    • Structure prediction (AlphaFold2/RoseTTAFold) → Validation by crosslinking or spectroscopy

    • Binding site prediction → Targeted mutagenesis and binding assays

    • Functional annotation via homology → Phenotypic testing of predicted functions

    • Protein-protein interaction prediction → Co-immunoprecipitation verification

  • Experimental Data → Computational Refinement:

    • Crosslinking constraints → Improved structural modeling

    • Mutagenesis results → Refined functional site mapping

    • Phenotypic data → Enhanced systems biology models

    • Binding assay results → Optimized docking algorithms

Iterative Optimization Process:

StageComputational MethodsExperimental MethodsIntegration Strategy
InitialSequence analysis, structure predictionExpression, purificationGenerate working hypotheses
RefinementMolecular dynamics, dockingSite-directed mutagenesis, binding assaysTest specific mechanistic predictions
Systems-levelNetwork analysis, pathway modelingGlobal omics studies, phenotypic screensPlace protein in biological context
ApplicationDrug design, resistance modelingInhibitor testing, clinical isolate analysisDevelop translational outcomes

Benefits of Integration:

  • Reduction in experimental space through computational prioritization

  • Enhanced structural models through experimental constraints

  • More robust functional hypotheses through multiple lines of evidence

  • Accelerated discovery timeline through parallel approaches

  • Deeper mechanistic understanding through complementary insights

This integrated approach transforms the traditional linear research pipeline into a dynamic, iterative process where computational predictions guide experimental design, and experimental results inform computational refinement, creating a powerful cycle for functional discovery .

What potential biotechnological applications might emerge from detailed characterization of KPK_1462?

Detailed characterization of KPK_1462 could lead to several innovative biotechnological applications:

  • Antimicrobial Development:

    • If essential for bacterial survival, KPK_1462 could serve as a novel antibiotic target

    • Structure-based drug design for specific inhibitors

    • Potential for narrow-spectrum antibiotics targeting Klebsiella species

    • Development of combination therapies targeting membrane protein complexes

  • Biosensor Development:

    • Engineering KPK_1462 variants as sensitive detection systems for specific molecules

    • Creation of whole-cell biosensors incorporating modified KPK_1462

    • Development of label-free detection systems based on KPK_1462 binding properties

    • Integration into microfluidic diagnostic platforms

  • Membrane Protein Engineering:

    • Utilizing KPK_1462's stable transmembrane domains as scaffolds for synthetic biology

    • Creating chimeric proteins with novel functions for biotechnological applications

    • Developing improved membrane protein expression systems based on KPK_1462 insights

    • Engineering enhanced protein stability for industrial applications

  • Bioremediation Applications:

    • If involved in transport, adaptation for environmental contaminant processing

    • Development of engineered bacteria with modified KPK_1462 for pollutant degradation

    • Creation of immobilized membrane systems for industrial waste treatment

    • Design of biofiltration systems incorporating KPK_1462-based technology

  • Synthetic Biology Platforms:

    • Incorporation into artificial cell systems as membrane components

    • Development as orthogonal signaling components in synthetic circuits

    • Use as modular building blocks for membrane-associated synthetic biology applications

    • Integration into minimal cell designs

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.