Recombinant Klebsiella pneumoniae UPF0259 membrane protein KPK_3195 (KPK_3195)

What is the basic structure and sequence of KPK_3195?

KPK_3195 is a full-length (247 amino acids) UPF0259 membrane protein from Klebsiella pneumoniae. The complete amino acid sequence is: MSITAKSVYRDTGNFFRNQFITILLIALLCAFITVVLGHAFSPSDEQLSILSEGDNLAGSAGLFELVQNMTPEQQQVLLRASAASTFSGLVGNAILAGGVLLLIQLVSAGHRVSALRAIGASAPVLPKLLLLILFTTFLVQMGMMLVLVPGVLLAIVLAFAPIMLVQDKMGILSAMRSSM RLAWANLRLVAPAIIGWLVAKTLLLLFASSFAVLTPNVGAVVINTISNLISALLLIYLFRVYMLIRN .

The sequence analysis suggests the protein contains multiple transmembrane domains, which is consistent with its classification as a membrane protein. Hydrophobicity analysis would typically reveal multiple hydrophobic regions that likely span the membrane.

How does KPK_3195 relate to the pathogenicity of Klebsiella pneumoniae?

While the specific role of KPK_3195 in pathogenicity is not fully characterized in the available literature, it should be considered in the context of K. pneumoniae's broader pathogenic mechanisms. K. pneumoniae is known to colonize mucosal surfaces and spread to other tissues, causing various infections including liver abscesses, bacteremias, pneumonia, and urinary tract infections .

Four major components contribute to K. pneumoniae pathogenicity: the capsule, lipopolysaccharide, fimbriae, and siderophores . As a membrane protein, KPK_3195 may play a role in membrane integrity, transport functions, or interactions with host cells, potentially contributing to virulence, though specific studies on this protein's role in pathogenicity would be needed to confirm this.

What expression systems are suitable for producing recombinant KPK_3195?

Based on the available information, E. coli has been successfully used as an expression system for recombinant KPK_3195 . For membrane proteins like KPK_3195, the following methodological considerations are important:

• Expression vector selection: Vectors with T7 or similar strong but controllable promoters are recommended

• Host strain optimization: BL21(DE3), C41(DE3), or C43(DE3) strains may be particularly suitable as they are engineered for membrane protein expression

• Growth conditions: Lower temperatures (16-25°C) after induction can improve proper folding

• Induction protocol: Gradual induction with lower IPTG concentrations (0.1-0.5 mM) may increase yields of properly folded protein

Expression of membrane proteins often requires optimization of these parameters to achieve satisfactory yields of correctly folded, functional protein.

What are the optimal storage and handling conditions for recombinant KPK_3195?

According to the product information, recombinant KPK_3195 should be stored as follows:

• Long-term storage: Store at -20°C/-80°C upon receipt, with aliquoting recommended to minimize freeze-thaw cycles

• Buffer composition: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

• Reconstitution protocol:

  • Briefly centrifuge the vial before opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended)

  • Aliquot for long-term storage at -20°C/-80°C

• Working storage: Store working aliquots at 4°C for up to one week

• Stability considerations: Repeated freeze-thaw cycles should be avoided

These handling procedures are critical for maintaining protein stability and activity for experimental use.

How should I design experiments to study KPK_3195 function in relation to Klebsiella pneumoniae pathogenicity?

When designing experiments to investigate KPK_3195's role in pathogenicity, consider implementing a rigorous experimental design that addresses both causal propositions: "If X, then Y" and "If not X, then not Y" . This approach strengthens internal validity for causal inferences.

A comprehensive experimental design would include:

• Gene knockout studies:

  • Generate KPK_3195 deletion mutants

  • Compare virulence to wild-type strains in appropriate infection models

  • Complement the mutation to confirm phenotype specificity

• Protein localization studies:

  • Use fluorescent tags or immunolocalization to determine subcellular location

  • Examine co-localization with known virulence factors

• Interaction studies:

  • Identify protein binding partners through co-immunoprecipitation

  • Use bacterial two-hybrid systems to confirm specific interactions

• In vitro virulence assays:

  • Adhesion to epithelial cells

  • Resistance to serum killing

  • Biofilm formation capacity

• In vivo infection models:

  • Use appropriate animal models that reflect human disease

  • Include controls that account for potential confounding variables

How can I analyze potential contradictions in published research about KPK_3195 function?

When encountering seemingly contradictory findings about KPK_3195 function in the literature, a systematic approach to context analysis is essential. Based on methodologies for analyzing apparent contradictions in biomedical literature, consider these steps:

• Categorize contextual differences that might explain contradictions :

  • Internal patient factors (species differences, genetic background)

  • External factors (experimental conditions, methodologies)

  • Endogenous/exogenous factors (presence of other factors)

  • Known controversies in the field

  • True contradictions requiring further investigation

• Apply predication-based analysis:

  • Extract specific claims about KPK_3195 from multiple sources

  • Normalize terminology to ensure comparison of the same concepts

  • Identify directly contradictory claims

  • Analyze the surrounding context for each claim

• Experimental verification:

  • Design experiments that specifically address the contradictory claims

  • Replicate the original conditions of conflicting studies

  • Introduce systematic variations to identify context-dependent factors

A table mapping contextual factors against findings can help visualize potential patterns explaining apparent contradictions:

This structured approach can help resolve apparent contradictions and advance understanding of KPK_3195 function.

What bioinformatic approaches can predict functional domains and interactions of KPK_3195?

For predicting functional domains and interactions of KPK_3195, a multi-layered bioinformatic approach is recommended:

• Sequence-based domain prediction:

  • Use tools like PFAM, SMART, or InterPro to identify conserved domains

  • Apply transmembrane prediction algorithms (TMHMM, Phobius) to map membrane-spanning regions

  • Identify signal peptides using SignalP

• Structural prediction:

  • Generate 3D models using AlphaFold2 or RoseTTAFold

  • Validate models with PROCHECK or MolProbity

  • Analyze potential binding pockets using CASTp or FTSite

• Evolutionary analysis:

  • Perform multiple sequence alignments with homologous proteins

  • Identify conserved residues that may be functionally important

  • Construct phylogenetic trees to determine evolutionary relationships

• Protein-protein interaction prediction:

  • Use STRING, STITCH, or PrePPI to predict interaction partners

  • Apply coevolution-based methods to identify potential binding interfaces

  • Cross-reference with experimental interactome data from related species

• Integration with pathogenicity data:

  • Compare to virulence-associated membrane proteins in other pathogens

  • Identify potential host-pathogen interaction interfaces

  • Cross-reference with host immune recognition databases

The integration of these approaches provides a comprehensive view of potential functional aspects of KPK_3195 that can guide experimental validation.

What mixed-methods approaches are suitable for studying the role of KPK_3195 in K. pneumoniae infections?

A comprehensive understanding of KPK_3195's role can benefit from integrating both quantitative and qualitative research methods. Based on frameworks for integrating such data, consider this methodological approach:

• Quantitative components:

  • Develop metrics to quantify KPK_3195 expression levels under different conditions

  • Measure correlation between expression and virulence phenotypes

  • Use principal component analysis (PCA) to identify key variables affecting expression

  • Apply binary outcome modeling (e.g., logistic regression) to identify factors that predict functional significance

• Qualitative components:

  • Apply content thematic approach guided by established frameworks

  • Identify patterns in expression across different infection contexts

  • Triangulate observations across multiple experimental paradigms

• Integration strategy:

  • Use quantitative data to establish statistical relationships

  • Apply qualitative analysis to explain mechanisms and context-dependencies

  • Develop an integrated model that predicts KPK_3195 function in various conditions

This mixed-methods approach enables a more nuanced understanding of how KPK_3195 functions within the complex host-pathogen interaction environment.

How can I design experiments to determine if KPK_3195 contributes to antibiotic resistance?

Given K. pneumoniae's critical status as a carbapenem-resistant Enterobacteriaceae of concern to the WHO , investigating KPK_3195's potential role in antibiotic resistance requires careful experimental design:

• Comparative expression analysis:

  • Compare KPK_3195 expression levels between resistant and susceptible strains

  • Measure expression changes in response to antibiotic exposure

  • Correlate expression with minimum inhibitory concentration (MIC) values

• Genetic manipulation experiments:

  • Generate KPK_3195 knockout and overexpression strains

  • Measure changes in antibiotic susceptibility using standardized methods

  • Test across multiple antibiotic classes to determine specificity of effects

• Structural and functional studies:

  • Investigate if KPK_3195 directly interacts with antibiotics using binding assays

  • Determine if it functions in efflux systems or membrane permeability

  • Assess its role in stress responses that might indirectly affect resistance

• Experimental controls and validation:

  • Include appropriate control strains (e.g., knockout of known resistance genes)

  • Validate findings across multiple K. pneumoniae isolates

  • Confirm phenotypes with complementation studies

A sample experimental design matrix might look like this:

Where "Measure" indicates assessment of growth, membrane permeability, gene expression profiles, or other relevant parameters.

What purification strategies are most effective for KPK_3195 as a membrane protein?

Purification of membrane proteins like KPK_3195 presents unique challenges requiring specialized approaches:

• Membrane extraction optimization:

  • Test multiple detergents (DDM, LMNG, CHAPS) at various concentrations

  • Evaluate gentle extraction methods (styrene maleic acid lipid particles)

  • Compare extraction efficiency while monitoring protein activity

• Affinity purification protocol:

  • Utilize the His-tag for initial purification via IMAC

  • Optimize imidazole concentrations in washing and elution steps

  • Consider on-column refolding for improved functionality

• Secondary purification steps:

  • Size exclusion chromatography to separate monomeric from aggregated protein

  • Ion exchange chromatography for removing contaminants

  • Evaluate the necessity of amphipol or nanodisc reconstitution for stability

• Quality control assessments:

  • SDS-PAGE and western blotting to verify purity and integrity

  • Circular dichroism to assess secondary structure

  • Dynamic light scattering to evaluate homogeneity

  • Activity assays specific to predicted protein function

The optimal purification strategy should be determined empirically, as membrane proteins vary considerably in their behavior during purification processes.

How can I critically evaluate sources and research claims about KPK_3195?

When evaluating research sources and claims about KPK_3195, apply these methodological criteria based on academic research principles:

• Source evaluation framework:

  • Authority: Assess author credentials and institutional affiliations

  • Currency: Note publication dates and whether findings reflect recent advances

  • Purpose: Distinguish between research reports, reviews, and opinion pieces

  • Relevance: Determine direct applicability to specific KPK_3195 questions

  • Accuracy: Cross-reference with other sources and broader scientific consensus

• Claim evaluation method:

  • Distinguish between established facts, preliminary findings, and speculations

  • Assess methodological rigor using established criteria for experimental design

  • Evaluate statistical approaches and sample sizes

  • Consider potential conflicts of interest or funding biases

• Critical integration approach:

  • Triangulate findings across multiple independent studies

  • Identify consensus views versus outlier claims

  • Place specific KPK_3195 claims within broader understanding of membrane proteins

  • Consider both confirmatory and contradictory evidence

This structured evaluation framework supports evidence-based research decisions and helps avoid perpetuating unsubstantiated claims about KPK_3195 function.

What are promising future research directions for KPK_3195?

Based on current understanding of KPK_3195 and K. pneumoniae pathogenicity, several promising research directions emerge:

• Structure-function relationships:

  • High-resolution structural determination through cryo-EM or X-ray crystallography

  • Structure-guided functional analysis of key domains

  • Molecular dynamics simulations to understand membrane interactions

• Role in virulence and pathogenicity:

  • Systematic evaluation in infection models using gene knockout approaches

  • Investigation of potential interactions with known virulence factors

  • Host-pathogen interaction studies focusing on epithelial and immune cell responses

• Potential as a therapeutic target:

  • Druggability assessment through computational and experimental approaches

  • Development of specific inhibitors or antibodies targeting accessible domains

  • Evaluation of synergistic effects with existing antibiotics

• Comparative studies across K. pneumoniae strains:

  • Analysis of sequence variation in hypervirulent versus classical strains

  • Correlation of mutations with clinical outcomes

  • Population genetics approaches to understand selective pressures

Each of these directions builds upon the fundamental characterization of KPK_3195 to address significant questions related to K. pneumoniae infection biology and potential therapeutic interventions.

How can I develop rigorous controls for KPK_3195 functional studies?

Developing appropriate controls is essential for rigorous KPK_3195 functional studies:

• Genetic control strategies:

  • Generate multiple independent knockout or mutant lines

  • Include complementation controls with wild-type gene reintroduction

  • Create point mutations in specific domains as functional controls

  • Use closely related membrane proteins as specificity controls

• Expression control considerations:

  • Implement inducible expression systems with careful titration

  • Monitor protein levels with quantitative western blotting

  • Include both over-expression and under-expression conditions

  • Use empty vector controls matching the expression construct

• Experimental condition controls:

  • Include time-matched controls for all treatments

  • Test multiple concentrations/doses to establish dose-response relationships

  • Account for growth phase effects with synchronized cultures

  • Perform experiments under both standard and stress conditions

• Technical validation controls:

  • Include technical replicates to assess method reliability

  • Perform biological replicates across different batches/days

  • Use alternative methods to confirm key findings

  • Include positive and negative controls for all assays