Recombinant Klebsiella pneumoniae UPF0283 membrane protein KPK_3110 (KPK_3110)

Shipped with Ice Packs
In Stock

Description

Introduction

The subject of this article is Recombinant Klebsiella pneumoniae UPF0283 membrane protein KPK_3110 (KPK_3110). Proteins are composed of amino acid chains, with a typical protein containing about 400 amino acids . The sequence of amino acids determines the protein's three-dimensional shape, which dictates its interactions with other molecules and structures within organisms . This article aims to consolidate available information to provide a detailed overview of the protein.

Protein Structure

Proteins have four levels of structure: primary, secondary, tertiary, and quaternary .

  • Primary Structure Primary structure refers to the linear sequence of amino acids linked by peptide bonds .

  • Secondary Structure Secondary structure describes how the amino acid sequence folds upon itself, determined by backbone interactions and primarily stabilized by hydrogen bonds . Common motifs include alpha helices and beta sheets .

  • Tertiary Structure Tertiary structure involves higher-order folding within a polypeptide chain, depending on distant group interactions . It is stabilized by hydrogen bonds, van der Waals interactions, hydrophobic packing, and disulfide bridge formation .

  • Quaternary Structure Quaternary structure refers to the arrangement of multiple folded protein subunits within a multi-subunit complex . Not all proteins have a quaternary structure . Examples of proteins with quaternary structure include hemoglobin, DNA polymerase, ribosomes, antibodies, and ion channels .

Results Section of a Scientific Paper

When writing the results section of a scientific paper, it is important to clearly articulate the study's findings, using tables and figures to enhance understanding . The sequence of results, data in tables, and information in figures should be definitively indicated . Use precise numerical terms, maintaining a consistent number of digits after decimal points . Report data as mean/median ± standard deviation, and include ranges for values like age and scale scores . Numerical values corresponding to percentages should also be indicated .

Tables in Scientific Writing

Tables are essential for organizing detailed or complicated data in scientific papers, allowing readers to quickly understand the results .

  • Ensure the table title clearly describes the content .

  • Column headings should be descriptive and indicate the data's nature .

  • Write table titles in the past tense, providing information about what is presented without summarizing or interpreting the results .

  • Design each table to be understandable on its own, without needing to refer to the text .

  • When presenting large amounts of information, divide the data into clear categories with accurate column titles .

  • Limit the number of tables to those providing essential information not adequately presented in the text .

  • Include only results relevant to the questions in the introduction .

Table 1, below, describes how to choose between tables, figures, and text to present data .

Table 1: Data Presentation Methods

Use a TableUse a FigureUse Text
To show many precise numerical values and specific data in a small spaceTo show trends, patterns, and relationships across and between datasetsWhen you don't have extensive data to present
To compare and contrast data values with several shared characteristics/variablesTo summarize research resultsWhen a table would have two or fewer columns
To show the presence or absence of specific characteristicsTo present a visual explanation of a sequence of events, procedures, or characteristicsWhen the data is irrelevant to the main study findings

Function and Regulation of BECLIN1

BECLIN1 is a regulator of autophagy, essential for mammalian survival . It works with other proteins to form Class III Phosphoinositide 3-Kinase (PI3K) complexes, which are critical for autophagy and membrane trafficking . Studies have explored BECLIN1's structural, biophysical, and biochemical properties, revealing how it regulates autophagy and membrane trafficking .

Conserved Domains

Conserved domains are recurring units in molecular evolution, with extents determined by sequence and structure analysis .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If a specific tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
KPK_3110; UPF0283 membrane protein KPK_3110
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Klebsiella pneumoniae (strain 342)
Target Names
KPK_3110
Target Protein Sequence
MSEPLKPRIDFDGPLQAEKIPPLKSARAFDTLEADNFAPARLVTGEEEEGAAEAVVESVL RPKRSLWRRMVSAGLAIFGVSVVAQGVQWTANAWQTQDWIALGGCVAGALIVGAGVGSVA TEWRRLWRLRQRAHERDEARDMLHSHAVGKAKAFCEKLAQQAGLDQSHPALQRWYAAIHE TQSDREVVSLYAQLVQPVLDAQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFRLVLLNIAFAGASELVREVGMDWMSQDLAARLSARAAQGIG AGLLTARLGIKAMELCRPLPWIADDKPRLGDFRRELIGQLKETLQKSKTSPEK
Uniprot No.

Target Background

Database Links

KEGG: kpe:KPK_3110

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal expression systems for producing recombinant KPK_3110?

The expression of membrane proteins like KPK_3110 requires careful consideration of expression systems. Based on similar membrane protein studies, Escherichia coli remains a primary choice for initial expression attempts due to its rapid growth, well-established genetic tools, and cost-effectiveness . For KPK_3110 specifically, an approach similar to that used for K. pneumoniae OmpA could be employed, where fusion of a short peptide to the N-terminus facilitated high-level expression of the recombinant protein .

When working with E. coli expression systems, several factors require optimization:

  • Vector selection: pET-based vectors with T7 promoters offer strong, inducible expression

  • E. coli strains: BL21(DE3), C41(DE3), or C43(DE3) strains are engineered for membrane protein expression

  • Induction conditions: Lower temperatures (16-25°C) and reduced inducer concentrations often improve proper folding

  • Media formulation: Enriched media containing glucose or glycerol can enhance membrane protein yields

If E. coli systems prove challenging, alternative expression hosts including yeast (Pichia pastoris), insect cells (using baculovirus), or mammalian cell lines might be considered, particularly if post-translational modifications or specific folding environments are required for functional expression.

What purification protocols yield the highest purity and structural integrity for KPK_3110?

Purification of KPK_3110 requires specialized approaches to maintain protein stability while removing the hydrophobic membrane environment. A methodical purification strategy would include:

  • Membrane isolation: Bacterial cells expressing KPK_3110 should be lysed (typically via mechanical disruption or sonication), followed by differential centrifugation to isolate the membrane fraction.

  • Solubilization: The membrane fraction containing KPK_3110 must be solubilized using appropriate detergents. Initial screening of multiple detergents is recommended, with common options including:

    • n-Dodecyl β-D-maltoside (DDM)

    • n-Decyl-β-D-maltopyranoside (DM)

    • Lauryl maltose neopentyl glycol (LMNG)

  • Affinity chromatography: If KPK_3110 is expressed with an affinity tag (commonly His6, Strep-tag II, or FLAG tag), corresponding affinity chromatography can be employed for initial capture.

  • Size exclusion chromatography (SEC): This serves as both a purification step and a quality control method to ensure the protein is monodisperse and not forming aggregates.

For membrane proteins like KPK_3110, maintaining stability throughout purification is critical. Addition of glycerol (10-20%) to buffers can enhance stability, as indicated by the storage recommendations for this protein . The final purified protein should be stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for long-term storage, with repeated freeze-thaw cycles being avoided .

What are the methodological challenges in structural determination of KPK_3110 using cryo-EM, and how can they be overcome?

Structural determination of sub-100 kDa membrane proteins like KPK_3110 presents significant challenges for cryo-electron microscopy (cryo-EM). These challenges stem from multiple factors and require specialized approaches to overcome:

Challenge 1: Size limitations
Membrane proteins under 100 kDa, such as KPK_3110, fall below the traditional size threshold for single-particle cryo-EM analysis .

Methodological solution:

  • Implement Volta phase plates to enhance contrast

  • Utilize direct electron detectors with improved signal-to-noise ratios

  • Apply advanced image processing algorithms specifically designed for smaller proteins

  • Consider protein engineering approaches to increase apparent molecular weight, such as fusion with larger protein domains or antibody fragments

Challenge 2: Protein extraction and stability
The hydrophobic nature of membrane proteins leads to conformational instability when removed from their native lipid environment .

Methodological solution:

  • Screen multiple detergent and lipid combinations systematically

  • Consider nanodiscs or amphipols as alternatives to traditional detergents

  • Implement GraFix technique (gradient fixation) to stabilize protein conformations

  • Employ lipid nanodiscs to maintain a native-like membrane environment

Challenge 3: Sample heterogeneity
Membrane proteins often exist in multiple conformational states, complicating structural determination .

Methodological solution:

  • Apply 3D variability analysis during image processing

  • Consider biochemical approaches to lock the protein in specific conformational states

  • Implement extensive 2D and 3D classification steps in data processing

  • Use focused classification techniques to resolve specific domains or regions

Challenge 4: Low expression yields
Sub-100 kDa membrane proteins like KPK_3110 often express at lower levels than their larger counterparts .

Methodological solution:

  • Optimize expression constructs with fusion tags or expression enhancers

  • Scale up production to compensate for lower yields

  • Consider cell-free expression systems specialized for membrane proteins

  • Implement high-throughput screening of expression conditions

Recent advances in cryo-EM technology have made structural determination of smaller membrane proteins increasingly feasible, with researchers successfully resolving structures of membrane proteins in the 50-100 kDa range through careful optimization of sample preparation and data collection parameters .

How can KPK_3110 be incorporated into outer membrane vesicles (OMVs) for functional studies and vaccine development?

Outer membrane vesicles (OMVs) derived from K. pneumoniae have emerged as promising platforms for functional studies and vaccine development . Incorporating KPK_3110 into OMVs offers several advantages for studying protein function and developing immunogenic formulations.

Methodological approach for OMV-based studies of KPK_3110:

  • Native expression approach:

    • Upregulate native KPK_3110 expression in K. pneumoniae through promoter engineering

    • Isolate OMVs containing naturally incorporated KPK_3110 through ultracentrifugation

    • Verify protein incorporation using western blotting and mass spectrometry

  • Heterologous expression approach:

    • Create fusion constructs of KPK_3110 with known OMV-targeting sequences

    • Express modified constructs in engineered K. pneumoniae strains

    • Optimize culture conditions to maximize OMV production and protein incorporation

  • Quality control and verification:

    • Perform proteomic analysis of isolated OMVs to confirm KPK_3110 incorporation

    • Use transmission electron microscopy to verify OMV morphology and integrity

    • Assess protein orientation using surface accessibility assays with antibodies

  • Functional studies with KPK_3110-containing OMVs:

    • Evaluate interaction with host cells through binding assays and cellular uptake studies

    • Assess immunomodulatory properties through in vitro immune cell stimulation

    • Investigate potential roles in antibiotic resistance through MIC determination assays

For vaccine development applications, KPK_3110-containing OMVs could serve as potent immunogens, similar to the demonstrated carrier properties of other K. pneumoniae membrane proteins . The natural adjuvant properties of OMVs, combined with the presentation of KPK_3110 in its native membrane context, make this approach particularly promising for generating protective immune responses against K. pneumoniae infections .

What experimental approaches can elucidate the functional role of KPK_3110 in K. pneumoniae virulence and antibiotic resistance?

Understanding the functional role of KPK_3110 in K. pneumoniae biology requires a multi-faceted experimental approach. The following methodological framework can systematically investigate its potential contributions to virulence and antibiotic resistance:

Genetic manipulation strategies:

  • Gene deletion and complementation:

    • Create KPK_3110 knockout mutants using CRISPR-Cas9 or homologous recombination

    • Develop complementation strains expressing wild-type KPK_3110 from plasmids

    • Generate point mutants targeting conserved residues for structure-function analysis

  • Expression modulation:

    • Implement inducible expression systems to control KPK_3110 levels

    • Create reporter fusions to monitor expression under different environmental conditions

    • Apply ribosome-binding site engineering to fine-tune expression levels

Functional characterization approaches:

  • Virulence phenotype assessment:

    • Compare wild-type and KPK_3110 mutant strains in infection models (cell culture, invertebrate, and murine)

    • Evaluate biofilm formation capacity using crystal violet staining and confocal microscopy

    • Assess resistance to host defense mechanisms (serum resistance, phagocytosis assays)

  • Antibiotic susceptibility testing:

    • Determine minimum inhibitory concentrations (MICs) for multiple antibiotic classes

    • Perform time-kill assays to assess killing kinetics

    • Evaluate membrane permeability using fluorescent dye uptake assays

  • Protein interaction studies:

    • Identify interaction partners through pull-down assays and mass spectrometry

    • Verify specific interactions using bacterial two-hybrid systems

    • Map interaction domains through systematic deletion constructs

  • Membrane integrity assessment:

    • Measure outer membrane permeability using NPN uptake assays

    • Evaluate membrane potential maintenance using fluorescent probes

    • Assess lipopolysaccharide (LPS) profiles through gel electrophoresis and mass spectrometry

By systematically applying these approaches, researchers can build a comprehensive understanding of KPK_3110's functional role in K. pneumoniae biology, potentially revealing new targets for therapeutic intervention against this increasingly problematic pathogen.

What are the optimal storage conditions for maintaining KPK_3110 stability and activity?

The stability of membrane proteins like KPK_3110 is critically dependent on proper storage conditions. Based on established protocols for recombinant KPK_3110, the following storage guidelines should be implemented:

Short-term storage (up to 1 week):

  • Store working aliquots at 4°C in Tris-based buffer containing 50% glycerol

  • Maintain protein in the presence of the detergent used for purification, typically at a concentration just above its critical micelle concentration (CMC)

  • Include protease inhibitors to prevent degradation

Medium-term storage (weeks to months):

  • Store at -20°C in Tris-based buffer with 50% glycerol

  • Divide into small aliquots (50-100 μL) to minimize freeze-thaw cycles

  • Seal containers tightly to prevent concentration changes due to evaporation or sublimation

Long-term storage (months to years):

  • Store at -80°C in Tris-based buffer with 50% glycerol

  • Flash-freeze aliquots in liquid nitrogen before transferring to -80°C storage

  • Consider lyophilization for very long-term storage, though refolding may be required upon reconstitution

Critical considerations:

  • Repeated freezing and thawing must be avoided as it leads to protein aggregation and loss of function

  • The pH of storage buffers should be maintained between 7.0-8.0 to minimize chemical degradation

  • Addition of specific lipids may enhance long-term stability of membrane proteins like KPK_3110

  • For functional assays, always verify protein integrity after storage via size exclusion chromatography or activity assays

Researchers should maintain detailed records of protein batch stability under various storage conditions, as minor variations in purification or buffer composition can significantly impact long-term stability profiles.

How can researchers optimize experimental design for studying KPK_3110 interactions with host cells?

Studying interactions between KPK_3110 and host cells requires careful experimental design to generate reliable and reproducible results. The following methodological framework provides a systematic approach:

Selection of appropriate cellular models:

  • Cell line selection considerations:

    • Choose cell lines representing relevant host tissues (respiratory epithelial cells for pneumonia studies, urinary tract epithelial cells for UTI research)

    • Consider primary cells versus established cell lines based on research questions

    • Include both immune and non-immune cell types to assess differential interactions

  • Experimental design principles:

    • Implement factorial design approaches to simultaneously evaluate multiple variables

    • Use appropriate controls for each experimental condition

    • Apply response surface methodology to optimize interaction conditions

Protein preparation for interaction studies:

  • Labeling strategies:

    • Fluorescent labeling (direct conjugation of fluorophores to purified KPK_3110)

    • Epitope tagging (FLAG, HA, or V5 tags) for antibody-based detection

    • Biotin labeling for streptavidin-based detection and pull-down assays

  • Delivery formats:

    • Purified protein in detergent micelles or nanodiscs

    • Protein incorporated into liposomes or outer membrane vesicles

    • Expression by host cells via transfection or transduction

Quantitative analysis approaches:

  • Binding assessment:

    • Flow cytometry for quantitative single-cell analysis

    • Surface plasmon resonance (SPR) for real-time binding kinetics

    • Cellular ELISA for high-throughput screening

  • Functional assessment:

    • Transcriptome analysis (RNA-seq) to measure host cell response

    • Signaling pathway activation (phosphorylation cascades, NF-κB translocation)

    • Cytokine/chemokine production profiles

  • Visualization techniques:

    • Confocal microscopy for subcellular localization

    • Super-resolution microscopy for detailed interaction mapping

    • Live-cell imaging for temporal dynamics

Data analysis and validation:

  • Statistical approaches:

    • Apply appropriate statistical tests based on experimental design

    • Use power analysis to determine adequate sample sizes

    • Implement correction for multiple comparisons in high-dimensional data

  • Validation strategies:

    • Confirm key findings using multiple detection methods

    • Verify specificity through competition assays with unlabeled protein

    • Employ genetic approaches (CRISPR knockout of putative receptors) to validate interactions

By rigorously applying these methodological principles, researchers can generate high-quality data on KPK_3110 interactions with host cells while minimizing artifacts and experimental variability.

What are the critical quality control parameters for assessing KPK_3110 preparations before functional studies?

Before conducting functional studies with recombinant KPK_3110, comprehensive quality control is essential to ensure the protein preparation meets stringent standards for purity, integrity, and conformational homogeneity. The following critical parameters should be systematically assessed:

1. Purity assessment:

  • SDS-PAGE analysis:

    Protein should appear as a single band with minimal contaminants (≥95% purity)
    For membrane proteins, anomalous migration patterns may occur due to detergent binding

  • Mass spectrometry verification:

    Intact mass analysis to confirm expected molecular weight
    Peptide mass fingerprinting after protease digestion to verify sequence coverage

2. Structural integrity assessment:

  • Size exclusion chromatography (SEC):

    Monodisperse peak indicating homogeneous preparation
    Absence of aggregates or degradation products

  • Circular dichroism (CD) spectroscopy:

    Secondary structure content consistent with predicted values
    Thermal stability assessment through temperature ramping

  • Intrinsic fluorescence:

    Tryptophan fluorescence emission spectra to assess tertiary structure
    Quenching studies to evaluate accessibility of aromatic residues

3. Functional verification:

  • Ligand binding assays:

    If ligands are known, binding should be verified through appropriate assays
    Microscale thermophoresis or isothermal titration calorimetry for quantitative binding parameters

  • Activity assays:

    For enzymes, catalytic activity should be measured
    For transporters, reconstitution into liposomes and transport assays

4. Membrane protein-specific assessments:

  • Detergent content analysis:

    Quantification of bound detergent using colorimetric assays
    Assessment of detergent-to-protein ratio

  • Lipid content analysis:

    Identification and quantification of co-purified lipids
    Supplementation with specific lipids if required for stability

5. Batch consistency verification:

  • Lot-to-lot comparison:

    Overlaid SEC profiles to verify consistent oligomeric state
    Consistent specific activity across preparations

  • Stability monitoring:

    Time-course analysis to determine shelf-life under storage conditions
    Freeze-thaw stability assessment

Implementing this comprehensive quality control regimen ensures that functional studies are conducted with protein preparations of consistent quality, enhancing reproducibility and reliability of experimental outcomes. Documentation of all quality parameters should be maintained for each protein preparation used in subsequent studies.

How can structural information about KPK_3110 contribute to developing targeted antimicrobial strategies?

Structural characterization of membrane proteins like KPK_3110 provides essential insights that can drive the development of novel antimicrobial strategies against increasingly resistant K. pneumoniae strains. The methodological path from structure to therapeutic application involves several key stages:

Structure determination approaches:

  • Cryo-EM analysis strategies:

    • Implement advanced sample preparation techniques for sub-100 kDa membrane proteins

    • Apply focused refinement approaches to resolve dynamic regions

    • Utilize computational methods to enhance resolution of transmembrane domains

  • Complementary structural methods:

    • X-ray crystallography of stabilized constructs

    • NMR spectroscopy for dynamic regions and ligand interactions

    • Crosslinking mass spectrometry for spatial constraints

Structure-based drug discovery pathway:

  • Identification of druggable sites:

    • Computational pocket detection algorithms

    • Conservation analysis across K. pneumoniae strains

    • Comparison with homologous proteins in other pathogens versus hosts

  • Virtual screening approaches:

    • Molecular docking of compound libraries against identified pockets

    • Fragment-based screening for initial chemical matter

    • Molecular dynamics simulations to identify transient pockets

  • Structure-activity relationship development:

    • Iterative structural analysis of protein-ligand complexes

    • Medicinal chemistry optimization guided by structural insights

    • Biophysical characterization of binding interactions

If KPK_3110 proves essential for K. pneumoniae pathogenesis or antibiotic resistance, structure-based design of inhibitors could lead to novel therapeutic agents. Even if the protein itself is not directly druggable, structural insights may reveal mechanisms that could be exploited through alternative approaches, such as developing antibodies that recognize surface-exposed epitopes for immunotherapy or diagnostic applications.

The ongoing evolution of computational methods for predicting protein structures, exemplified by AlphaFold2 and RoseTTAFold, provides additional avenues for generating structural hypotheses about KPK_3110 that can guide experimental design even before high-resolution experimental structures are determined.

What potential exists for developing KPK_3110-based vaccines against K. pneumoniae infections?

The development of vaccines targeting K. pneumoniae remains a significant challenge, particularly against hypervirulent and antibiotic-resistant strains. KPK_3110, as a membrane protein, presents several characteristics that make it a potential vaccine candidate, while also requiring specific methodological approaches to overcome challenges inherent to membrane protein-based vaccines.

Immunological assessment of KPK_3110:

  • Epitope mapping and analysis:

    • In silico prediction of B-cell and T-cell epitopes within KPK_3110 sequence

    • Experimental validation through peptide arrays and T-cell activation assays

    • Assessment of epitope conservation across diverse K. pneumoniae strains

  • Immunogenicity evaluation:

    • Analysis of pre-existing antibodies in patient populations

    • Determination of MHC presentation efficiency for identified T-cell epitopes

    • Assessment of immunodominant regions through vaccination studies

Vaccine formulation strategies:

  • Recombinant protein approaches:

    • Full-length KPK_3110 in detergent micelles or nanodiscs

    • Extracellular domain fragments with enhanced solubility

    • Epitope-focused constructs presenting key immunogenic regions

  • OMV-based vaccine platforms:

    • Natural OMVs with enhanced KPK_3110 expression

    • Engineered OMVs with optimized KPK_3110 presentation

    • Detergent-extracted OMVs with controlled protein composition

  • Genetic vaccine platforms:

    • DNA vaccines encoding KPK_3110

    • mRNA vaccines for enhanced protein expression

    • Viral vector vaccines for efficient delivery

Adjuvant selection for optimal response:

  • Traditional adjuvants:

    • Aluminum salts for enhanced antibody responses

    • Oil-in-water emulsions for balanced humoral and cellular immunity

  • Pattern recognition receptor (PRR) agonists:

    • TLR agonists targeting specific immune activation pathways

    • NOD-like receptor activators for intracellular sensing

    • STING pathway activators for enhanced type I interferon responses

The carrier properties demonstrated by other K. pneumoniae membrane proteins suggest that KPK_3110 may similarly serve as an effective carrier for epitopes from other K. pneumoniae antigens . This conjugate approach could broaden protection against multiple virulence factors simultaneously.

Careful consideration of immunological challenges is essential, including potential antigenic variation across strains, risk of enhancing inflammatory responses during infection, and the need for balanced humoral and cellular immunity for effective protection against this intracellular pathogen.

How might systems biology approaches enhance our understanding of KPK_3110's role in K. pneumoniae pathophysiology?

Systems biology offers powerful methodological approaches to contextualize KPK_3110 within the broader molecular networks of K. pneumoniae pathophysiology. By integrating multiple data types and computational modeling, researchers can develop comprehensive insights into the protein's functional significance.

Multi-omics integration strategies:

  • Transcriptomic approaches:

    • RNA-seq analysis comparing wild-type and KPK_3110 knockout strains under various conditions

    • Single-cell RNA-seq to capture population heterogeneity in expression

    • Ribosome profiling to assess translational regulation of KPK_3110 and related genes

  • Proteomic analysis:

    • Comparative proteomics of membrane fractions with and without KPK_3110

    • Protein-protein interaction mapping through proximity labeling approaches

    • Post-translational modification analysis to identify regulatory mechanisms

  • Metabolomic profiling:

    • Analysis of metabolic changes in KPK_3110 mutants

    • Flux analysis using stable isotope labeling

    • Identification of metabolites affected by KPK_3110 function

Network analysis frameworks:

  • Protein interaction networks:

    • Construction of KPK_3110-centered interaction networks

    • Identification of functional modules containing KPK_3110

    • Comparative analysis of network perturbations in different conditions

  • Gene regulatory networks:

    • Identification of transcription factors controlling KPK_3110 expression

    • Mapping of downstream genes regulated in response to KPK_3110 activity

    • Network motif analysis to identify regulatory patterns

  • Host-pathogen interaction networks:

    • Integration of bacterial and host factors interacting with KPK_3110

    • Temporal mapping of interaction dynamics during infection

    • Identification of key nodes for therapeutic targeting

Computational modeling approaches:

  • Constraint-based metabolic modeling:

    • Development of genome-scale metabolic models incorporating KPK_3110 function

    • Flux balance analysis to predict metabolic consequences of KPK_3110 perturbation

    • Integration of transcriptomic data to generate condition-specific models

  • Agent-based modeling:

    • Simulation of infection dynamics incorporating KPK_3110 function

    • Prediction of emergent properties at the population level

    • In silico testing of intervention strategies

  • Machine learning applications:

    • Feature extraction from multi-omics data to identify KPK_3110-associated signatures

    • Predictive modeling of virulence or antibiotic resistance based on KPK_3110 status

    • Classification of clinical isolates based on systems-level signatures

By applying these systems biology approaches, researchers can move beyond reductionist studies of KPK_3110 to understand its contributions within the complex, interconnected networks governing K. pneumoniae pathophysiology. This integrative understanding can reveal emergent properties not apparent from isolated studies and identify optimal points for therapeutic intervention.

What are the key methodological recommendations for researchers beginning work with KPK_3110?

For researchers initiating studies on KPK_3110, a structured methodological approach is essential to overcome the inherent challenges of membrane protein research while maximizing the likelihood of successful outcomes. Based on the information available for KPK_3110 and related membrane proteins, the following integrated recommendations are provided:

Starting point: Expression and purification strategy

Begin with a systematic optimization of expression conditions:

  • Test multiple expression constructs with different fusion tags (His6, Strep-tag II, MBP fusion)

  • Screen E. coli strains specifically designed for membrane protein expression (C41/C43, Lemo21)

  • Implement a small-scale expression screening platform before scaling up

  • Optimize induction conditions (temperature, inducer concentration, duration)

For purification, adopt a multi-step approach:

  • Establish efficient membrane isolation protocols

  • Screen multiple detergents simultaneously in initial extraction step

  • Implement a minimum two-step chromatography process (affinity + size exclusion)

  • Rigorously assess protein quality after each purification step

Intermediate stage: Structural and functional characterization

Parallel investigation of structure and function:

  • Pursue multiple structural approaches simultaneously (cryo-EM, crystallization trials)

  • Develop robust functional assays based on predicted protein roles

  • Generate a panel of site-directed mutants targeting conserved residues

  • Establish reliable quality control metrics before proceeding to complex experiments

Advanced investigations: Systems-level integration

Contextualize findings within broader biological systems:

  • Implement comparative studies across multiple K. pneumoniae strains

  • Develop infection models to validate in vitro findings

  • Apply multi-omics approaches to map system-wide effects of KPK_3110 perturbation

  • Collaborate across disciplines to integrate diverse expertise

By following this strategic roadmap, researchers can efficiently navigate the challenges associated with KPK_3110 research while building a comprehensive understanding of this protein's structure, function, and biological significance. Maintaining rigorous documentation of methodological details is essential for reproducibility and collective advancement of knowledge about this membrane protein.

What are the most promising future research directions for KPK_3110 studies?

Based on current knowledge and technological capabilities, several research directions hold particular promise for advancing our understanding of KPK_3110 and translating this knowledge into clinical applications. These future directions represent areas where methodological innovations and scientific questions intersect to create high-impact opportunities:

Structural biology frontiers:

  • Integrative structural biology approaches:

    • Combining cryo-EM, crosslinking mass spectrometry, and computational modeling

    • Capturing multiple conformational states to understand dynamic behavior

    • Resolving the structure in complex with interaction partners

  • In situ structural determination:

    • Cryo-electron tomography of KPK_3110 in its native membrane environment

    • Correlative light and electron microscopy to link structure and function

    • Membrane protein dynamics through time-resolved structural methods

Functional characterization opportunities:

  • Precision genetic approaches:

    • CRISPR interference for tunable gene expression modulation

    • Base editing for targeted amino acid substitutions

    • Deep mutational scanning to comprehensively map structure-function relationships

  • Advanced phenotyping technologies:

    • Single-cell tracking during infection processes

    • Microfluidic approaches for controlled environmental manipulations

    • Host-pathogen interface imaging with super-resolution techniques

Translational research directions:

  • Immunotherapeutic development:

    • Monoclonal antibody generation targeting surface-exposed epitopes

    • Bispecific antibodies linking KPK_3110 recognition to immune effector functions

    • Assessment of passive immunization strategies in animal models

  • Diagnostic applications:

    • Development of KPK_3110-based detection methods for K. pneumoniae

    • Biosensor technologies incorporating recombinant protein or antibodies

    • Point-of-care testing for rapid identification of hypervirulent strains

  • Vaccine platform innovation:

    • Structure-based immunogen design focusing on protective epitopes

    • Nanoparticle presentation of KPK_3110 epitopes for enhanced immunogenicity

    • Combination vaccines incorporating multiple antigens from K. pneumoniae

The convergence of technological advances in structural biology, genetic engineering, and immunology creates unprecedented opportunities to understand and target membrane proteins like KPK_3110. Collaborative, multidisciplinary approaches that bridge basic science and clinical applications hold the greatest promise for translating fundamental knowledge about this protein into meaningful advances in the prevention and treatment of K. pneumoniae infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.