Recombinant Klebsiella pneumoniae UPF0442 protein KPK_4801 (KPK_4801)

Shipped with Ice Packs
In Stock

Description

Introduction to KPK_4801

Recombinant Klebsiella pneumoniae UPF0442 protein KPK_4801 (KPK_4801) is a full-length bacterial protein derived from Klebsiella pneumoniae, a pathogen linked to pneumonia, septicemia, and antibiotic-resistant infections . This recombinant protein is engineered for research purposes, typically expressed in Escherichia coli with an N-terminal His tag to facilitate purification and functional studies . Its UniProt identifier is B5Y298, and it spans 157 amino acids (1–157) in its native form .

Expression and Purification

KPK_4801 is produced via recombinant DNA technology in E. coli, leveraging its robust protein expression systems. The His tag enables affinity chromatography for high-purity isolation .

Challenges and Knowledge Gaps

  1. Functional Annotation: No documented pathways or interacting partners are linked to KPK_4801 in public databases .

  2. Experimental Data: No peer-reviewed studies directly investigating KPK_4801’s role in K. pneumoniae pathogenesis or host interaction.

  3. Comparative Analysis: Limited data on how KPK_4801 differs from other K. pneumoniae OMPs (e.g., Kpn_Omp001) in terms of immune modulation .

Future Research Directions

  • Structural Biology: Cryo-EM or X-ray crystallography to elucidate KPK_4801’s 3D structure and binding interfaces.

  • Host Interaction Studies: Co-immunoprecipitation (Co-IP) or yeast two-hybrid assays to identify human protein targets (e.g., P53, HIF1A, STAT1) .

  • Vaccine Formulation: Testing KPK_4801 as a component in multivalent vaccines targeting K. pneumoniae serotypes .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery information, please consult your local distributor.
Note: All protein shipments are standardly packed with blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is discouraged. For optimal usage, store working aliquots at 4°C for a maximum of one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which serves as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid formulations exhibit a shelf life of 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize its implementation.
Synonyms
KPK_4801; UPF0442 protein KPK_4801
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Klebsiella pneumoniae (strain 342)
Target Names
KPK_4801
Target Protein Sequence
MGIISFIFALAEDMLLAAIPAVGFAMVFNVPQRALRWCALLGAIGHGSRMVMMSAGFNIE WATFLAALLVGSIGIQWSRWYLAHPKIFTVAAVIPMFPGISAYTAMISAVKISHFGYSEE MMILLLSNFLKASSIVGALSIGLSIPGLWLYRKRPRV
Uniprot No.

Target Background

Database Links

KEGG: kpe:KPK_4801

Protein Families
UPF0442 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What are the physicochemical properties of KPK_4801 that researchers should consider?

    When working with recombinant KPK_4801, researchers should consider the following physicochemical properties:

    PropertyCharacteristic
    Length157 amino acids
    Molecular Weight17.1 kDa
    Purity>90% (as determined by SDS-PAGE)
    Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
    Storage Temperature-20°C/-80°C (aliquoting recommended)
    ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)
    StabilityAvoid repeated freeze-thaw cycles

    The protein's amino acid composition suggests it contains hydrophobic regions, which may influence experimental design and handling .

  • How is KPK_4801 protein structure predicted to relate to its function?

    While the search results don't provide explicit structural data for KPK_4801, sequence analysis suggests it may be a membrane-associated protein given its hydrophobic amino acid composition. The "UPF" designation (Uncharacterized Protein Family) indicates that detailed functional characterization remains limited.

    When designing experiments, researchers should consider that membrane proteins typically require specialized approaches for:

    • Solubilization (detergents may be necessary)

    • Purification (affinity chromatography with careful buffer selection)

    • Structural studies (crystallization challenges may be present)

    • Functional assays (membrane environment reconstruction may be necessary)

Expression and Purification Methods

  • What expression systems are most effective for producing recombinant KPK_4801?

    Based on available data, E. coli has been successfully employed for KPK_4801 expression. The specific approach involves:

    • Vector systems with His-tag fusion for purification

    • Expression of the full-length protein (amino acids 1-157)

    • Collection as lyophilized powder

    For optimizing expression in E. coli, consider these methodological approaches:

    1. Strain selection: BL21(DE3) strains are commonly used for recombinant protein expression

    2. Induction parameters: Test IPTG concentrations (typically 0.1-1.0 mM)

    3. Temperature modulation: Lower temperatures (16-25°C) during induction can improve solubility

    4. Media composition: Enriched media (e.g., TB or 2×YT) may increase yields

    5. Induction timing: Induction at mid-log phase (OD600 ~0.6-0.8) often optimal

  • What purification strategies yield the highest purity of recombinant KPK_4801?

    Current purification approaches rely on affinity chromatography using His-tagged recombinant KPK_4801. To achieve >90% purity, consider this methodological workflow:

    1. Cell lysis optimization:

      • Sonication in appropriate buffer (Tris-based)

      • Addition of lysozyme (0.1 volume of 10 mg/ml) may improve results

      • Include protease inhibitors to prevent degradation

    2. Affinity purification:

      • Ni-NTA or similar metal affinity resin

      • Include 10-50 mM imidazole in binding buffer to reduce non-specific binding

      • Step gradient elution with increasing imidazole concentrations

    3. Additional purification (if higher purity required):

      • Size exclusion chromatography

      • Ion exchange chromatography based on theoretical pI

    4. Quality control:

      • SDS-PAGE analysis

      • Western blotting with anti-His antibodies

      • Mass spectrometry verification

  • How can researchers overcome expression challenges with KPK_4801?

    When encountering difficulties expressing KPK_4801, researchers should systematically troubleshoot using these methodological approaches:

    1. For low expression levels:

      • Verify sequence integrity and reading frame

      • Add 2% glucose to growth medium to decrease basal expression from lac promoters

      • Optimize codon usage for the expression host

      • Test multiple E. coli strains (BL21, Rosetta, Origami)

    2. For insoluble protein/inclusion bodies:

      • Lower induction temperature (16-20°C)

      • Reduce inducer concentration

      • Co-express with chaperones

      • Consider solubility-enhancing fusion tags

    3. For protein degradation:

      • Use protease-deficient strains

      • Include protease inhibitors during purification

      • Optimize buffer composition

      • Minimize processing time and temperature

Advanced Research Applications

  • How can signal peptide optimization improve KPK_4801 expression?

    Research on signal peptide optimization shows that modification of N-terminal signal peptides and adjacent amino acids can significantly impact recombinant protein expression levels. For KPK_4801, consider:

    1. Testing the native signal peptide versus heterologous signal peptides (such as the computationally-designed "secrecon" signal peptide)

    2. Modifying the +1/+2 amino acid positions downstream of the signal peptide, as these significantly affect secreted protein levels. Research shows:

      • Favorable +1 position residues: alanine

      • Potentially detrimental +1 residues: cysteine, proline, tyrosine, glutamine

    3. Creating a panel of constructs with different signal peptide/adjacent amino acid combinations to identify optimal expression conditions

    This approach has enabled successful expression of previously refractory proteins and could be applied to KPK_4801 if expression proves challenging .

  • What experimental approaches can elucidate KPK_4801's role in K. pneumoniae pathogenesis?

    To investigate KPK_4801's potential role in pathogenesis, consider these methodological approaches:

    1. Gene knockout/knockdown studies:

      • CRISPR-Cas9 system for gene deletion

      • Antisense RNA for gene silencing

      • Measure impact on virulence in infection models

    2. Host-pathogen interaction studies:

      • Pull-down assays to identify host protein interactions

      • Immunoprecipitation followed by mass spectrometry

      • SARM1 and other host proteins may be relevant targets based on K. pneumoniae pathogenesis research

    3. Immune response analysis:

      • Measure inflammatory cytokine profiles (TNF-α, IL-1β, CXCL10)

      • Examine NF-κB and IRF3 pathway activation

      • Investigate type I IFN responses

  • How can advanced mass spectrometry techniques be applied to study KPK_4801?

    Recent innovations in mass spectrometry offer powerful approaches for KPK_4801 analysis:

    1. Rapid Evaporative Ionisation Mass Spectrometry (REIMS):

      • Enables direct analysis without complex sample preparation

      • Can monitor recombinant protein expression in bacterial cultures

      • Provides near-instantaneous results for expression monitoring

      • Method involves vaporizing samples with subsequent ionization and MS analysis (e.g., on Synapt G2si)

    2. Activity-Based Protein Profiling (ABPP):

      • Can identify functional activities of proteins

      • Useful for determining if KPK_4801 has enzymatic activity

      • Involves biotin-tagged probes with streptavidin enrichment and LC-MS/MS analysis

    3. Quantitative proteomics:

      • SILAC or TMT labeling to compare expression levels under different conditions

      • Interactome analysis to identify binding partners

  • What role might KPK_4801 play in K. pneumoniae immune evasion strategies?

    Research on K. pneumoniae pathogenesis reveals sophisticated immune evasion strategies that could potentially involve proteins like KPK_4801:

    1. SUMOylation pathway interference:

      • K. pneumoniae limits SUMOylation of host proteins

      • Affects SENP2 deSUMOylase via NEDDylation of Cullin-1

      • KPK_4801 could be investigated for potential roles in this process

    2. Toll-IL-1R protein manipulation:

      • K. pneumoniae exploits SARM1 to negatively regulate MyD88 and TRIF-governed inflammation

      • Experimental approaches should examine KPK_4801's potential interaction with these pathways

    3. Methodological approach:

      • Immunoblotting for SUMO1/2/3-conjugated proteins

      • Phosphorylation analysis of IKKα/β and IRF3

      • Cytokine profiling (TNF-α, IL-1β, CXCL10, type I IFNs)

Experimental Design Considerations

  • What controls should be included in experiments involving recombinant KPK_4801?

    Robust experimental design for KPK_4801 research requires appropriate controls:

    1. Expression controls:

      • Non-transformed host E. coli cells

      • Cells transformed with empty vector

      • Positive control with known highly-expressed protein

      • Western blotting with anti-His antibody to confirm identity

    2. Purification controls:

      • Flow-through fraction analysis

      • Elution with step gradient to assess binding specificity

      • SDS-PAGE of all fractions to monitor purification efficiency

    3. Functional assays:

      • Heat-inactivated KPK_4801

      • Scrambled/mutated protein sequence

      • Competitive inhibition controls if binding studies are performed

  • How can researchers verify the integrity and activity of purified KPK_4801?

    To ensure experimental reliability, verify recombinant KPK_4801 using:

    1. Physical characterization:

      • SDS-PAGE for size confirmation (expected ~17.1 kDa plus tag)

      • Mass spectrometry for exact mass determination

      • Circular dichroism for secondary structure assessment

      • Dynamic light scattering for aggregation analysis

    2. Immunological verification:

      • Western blotting with anti-His antibodies

      • If available, antibodies specific to KPK_4801

    3. Stability assessment:

      • Temperature sensitivity testing

      • pH stability profile

      • Freeze-thaw stability

      • Aggregation propensity under experimental conditions

  • What bioinformatic approaches can inform KPK_4801 research design?

    Computational analysis provides valuable insights to guide experimental design:

    1. Structural prediction:

      • Secondary structure prediction

      • Membrane topology analysis (given hydrophobic regions)

      • 3D modeling based on homologous proteins

      • Binding site prediction

    2. Functional analysis:

      • Conserved domain identification

      • Pathway involvement prediction

      • Protein-protein interaction network analysis

      • Pathogen-host interaction prediction

    3. Immunological predictions:

      • Epitope mapping for potential antibody development

      • MHC binding site prediction

      • Antigenicity assessment (useful if considering KPK_4801 as a potential vaccine target, similar to approaches used for OmpA)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.