Recombinant Klebsiella pneumoniae UPF0761 membrane protein KPK_5501 (KPK_5501)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
KPK_5501; UPF0761 membrane protein KPK_5501
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Klebsiella pneumoniae (strain 342)
Target Names
KPK_5501
Target Protein Sequence
MLKTVQQKLHHHTRPLLAWLKLLWRRIDEDHMTTLAGNLAYVSLLSLVPLIAVVFALFAA FPMFSEVSVQIRHFIFANFIPATGDVIQGYIEQFVANSSRMTAVGAFGLIVTSLLLMYSI DSALNTIWRSTRSRPKVYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLDGVIDNL LRLFPLILSWAAFWLLYSIVPTTQVRNRDAVIGALVAALLFEAGKKAFALYITTFPSYQL IYGVISVVPILFVWVYWTWCIVLLGAEITVTLGEYRKLKTEETEQP
Uniprot No.

Target Background

Database Links

KEGG: kpe:KPK_5501

Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant KPK_5501?

For optimal preservation of recombinant KPK_5501 protein activity and stability, the following storage protocol is recommended:

  • Store the lyophilized protein at -20°C/-80°C upon receipt

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • For short-term use, working aliquots can be stored at 4°C for up to one week

  • For reconstitution, use deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for long-term storage

This storage approach maintains protein integrity by minimizing denaturation risks from repeated temperature fluctuations. The protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability during the freeze-drying process .

What experimental design approach is most suitable for initial characterization of KPK_5501 function?

For initial characterization of KPK_5501 function, a structured experimental design is crucial. Consider implementing the following approach:

  • Define variables clearly:

    • Independent variables: Expression conditions, detergent types, lipid environments

    • Dependent variables: Protein stability, folding efficiency, functional activity

    • Control variables: Temperature, pH, buffer composition

  • Implement a true experimental design:

    • Use control groups (e.g., known membrane proteins) alongside experimental groups

    • Randomly distribute variables to minimize bias

    • Include appropriate replicates to ensure statistical significance

  • Follow a systematic experimental workflow:

Experimental PhaseKey MethodsMeasurements
Expression OptimizationVary temperature, induction conditionsProtein yield, solubility
Purification ProtocolTest different detergents, column typesPurity (SDS-PAGE >90%)
Stability AssessmentThermal shift assays, limited proteolysisTm values, degradation patterns
Functional CharacterizationBinding assays, reconstitution studiesBinding constants, activity measures

The experimental design should focus on isolating the effects of individual variables while controlling for extraneous factors that might confound results .

What are the primary challenges in expressing and purifying KPK_5501?

Membrane proteins like KPK_5501 present several challenges during expression and purification:

  • Expression challenges:

    • Toxicity to host cells due to membrane disruption

    • Protein misfolding and aggregation

    • Limited membrane real estate in expression systems

  • Purification challenges:

    • Maintaining native protein conformation during extraction

    • Selecting appropriate detergents that mimic the lipid bilayer

    • Balancing solubilization efficiency with protein stability

To address these challenges, implement a purification strategy that:

  • Uses mild detergents initially (DDM, LMNG)

  • Employs affinity chromatography leveraging the His-tag

  • Includes stability assessments at each purification step

  • Considers reconstitution into nanodiscs or liposomes for functional studies

How can experimental design approaches be optimized for studying KPK_5501 interactions with other proteins?

When investigating protein-protein interactions involving KPK_5501, a sophisticated experimental design is essential:

  • Variable identification and control:

    • Independent variables: Interacting proteins, buffer conditions, lipid composition

    • Dependent variables: Binding affinity, complex stability, functional outcomes

    • Confounding variables to control: Detergent effects, tag interference, non-specific binding

  • Experimental design implementation:

    • Factorial design to test multiple conditions simultaneously

    • Split-plot design for experiments involving different time scales

    • Randomized complete block design to account for batch effects

  • Recommended methodological workflow:

Interaction Analysis MethodTechnical ApproachKey Controls
Pull-down AssaysHis-tag affinity purificationTag-only controls, non-specific protein controls
Crosslinking MSDSS/BS3 crosslinkersNon-crosslinked samples, random crosslinking controls
Biolayer InterferometryHis-tagged KPK_5501 immobilizationReference sensors, buffer-only controls
Fluorescence-based MethodsFRET, fluorescence anisotropyDonor/acceptor-only controls, non-interacting protein pairs
  • Data analysis considerations:

    • Implement multiple hypothesis testing correction

    • Use statistical models that account for nested experimental designs

    • Apply machine learning algorithms to identify subtle interaction patterns

When studying membrane protein interactions, remember that these proteins must balance structural constraints of function against biosynthesis and folding requirements , which may influence interaction dynamics and specificity.

What approaches can resolve contradictory experimental data about KPK_5501 function?

When faced with contradictory data regarding KPK_5501 function, a systematic troubleshooting and reconciliation approach is necessary:

  • Experimental design assessment:

    • Review variable manipulation methodology

    • Evaluate control group appropriateness

    • Analyze randomization protocols

    • Consider sample sizes and statistical power

  • Methodological reconciliation strategy:

Contradiction TypeInvestigative ApproachResolution Method
Functional ReadoutsCompare assay sensitivity and specificityStandardize conditions across multiple assay platforms
Expression DependencyExamine expression systems and conditionsTest function across multiple cellular backgrounds
Structure-FunctionCompare purification methods and detergentsUse complementary structural techniques (X-ray, cryo-EM, NMR)
Environmental SensitivityAnalyze lipid/detergent compositionsSystematically vary membrane mimetics
  • Advanced reconciliation approach:

    • Implement Bayesian experimental design to update hypotheses based on accumulating evidence

    • Use causal inference methods to identify confounding variables

    • Develop computational models to predict conditions where contradictions might arise

    • Apply meta-analysis techniques to quantitatively compare results across studies

  • Membrane protein-specific considerations:

    • Remember that membrane proteins must balance functional constraints with biosynthesis requirements

    • Consider whether contradictions reflect different conformational states rather than experimental errors

    • Evaluate whether the His-tag is influencing functional readouts in different experimental setups

How can structural characterization of KPK_5501 inform functional hypotheses?

Structural characterization of KPK_5501 can significantly advance functional understanding through the following approaches:

  • Structure prediction and analysis:

    • Use the known amino acid sequence to generate structural predictions

    • Identify structural motifs consistent with known membrane protein families

    • Map conserved residues onto the predicted structure to identify potential functional sites

  • Structure-informed experimental design:

Structural ElementExperimental ApproachFunctional Insight
Transmembrane DomainsCysteine scanning mutagenesisMembrane topology validation
Conserved ResiduesAlanine substitution seriesIdentification of functional residues
Predicted Binding PocketsMolecular docking + validationSubstrate specificity determination
Oligomerization InterfacesDisulfide crosslinkingAssembly mechanism elucidation
  • Advanced structure-function analysis:

    • Implement molecular dynamics simulations to examine protein behavior in membrane environments

    • Use hydrogen-deuterium exchange mass spectrometry to probe dynamic regions

    • Apply deep mutational scanning to systematically map sequence-function relationships

    • Consider the balance between structural constraints of function and biosynthesis requirements

  • Specific KPK_5501 considerations:

    • The sequence (MLKTVQQKLHHH...) indicates a lysine-rich N-terminal region that may be involved in membrane interactions

    • Multiple hydrophobic stretches suggest several transmembrane domains

    • The C-terminal sequence (...ETEQP) contains charged residues that may participate in cytoplasmic interactions

What are effective approaches for reconstituting KPK_5501 into membrane mimetics for functional studies?

Reconstitution of KPK_5501 into membrane mimetics represents a critical step for functional characterization. Consider the following methodological approach:

  • Selection of appropriate membrane mimetic systems:

Mimetic SystemAdvantagesConsiderations for KPK_5501
Detergent MicellesSimple preparation, good for initial studiesMay not fully support native conformation
LiposomesNatural bilayer environment, variable lipid compositionChallenging protein orientation control
NanodiscsDefined size, accessible from both sidesRequires optimization of MSP:lipid:protein ratios
Polymer-based Systems (SMALP)Extraction with native lipidsLimited size control, potential polymer interference
  • Optimization of reconstitution protocols:

    • Detergent removal method selection (dialysis, biobeads, cyclodextrin)

    • Lipid composition optimization (consider native K. pneumoniae membrane lipids)

    • Protein:lipid ratio titration to determine optimal functional reconstitution

    • Quality control through size exclusion chromatography and negative-stain EM

  • Experimental design considerations:

    • Implement a systematic approach with controlled variables

    • Use true experimental design with appropriate controls

    • Consider the balance between structural constraints and biosynthesis requirements

  • Functional validation:

    • Develop activity assays specific to hypothesized function

    • Compare activity across different membrane mimetic systems

    • Assess protein stability and orientation in each system

    • Validate function through mutagenesis of predicted functional residues

For KPK_5501 specifically, start with the recommended buffer composition (Tris/PBS-based buffer, pH 8.0) and systematically explore detergent and lipid conditions that maintain protein stability while supporting functional activity.

What statistical approaches are most appropriate for analyzing KPK_5501 functional data?

  • Experimental design and statistical planning:

    • Define hypotheses clearly (null and alternative)

    • Determine sample sizes through power analysis

    • Select appropriate statistical tests based on data distribution and experimental design

    • Plan for multiple comparison corrections

  • Recommended statistical approaches by data type:

Data TypeStatistical MethodImplementation Considerations
Activity MeasurementsANOVA with post-hoc testsAccount for nested factors (e.g., protein batch)
Dose-ResponseNon-linear regression, EC50 comparisonConsider constraints in curve fitting parameters
Binding KineticsGlobal fitting of association/dissociationCompare one-site vs. multi-site binding models
Stability AssessmentsSurvival analysis, Boltzmann fittingAccount for censored data in thermal stability
  • Advanced statistical considerations:

    • Implement mixed-effects models for experiments with multiple sources of variation

    • Use Bayesian approaches for complex experimental designs

    • Consider machine learning methods for identifying patterns in complex datasets

    • Apply meta-analysis techniques when combining results across multiple experiments

  • Reporting standards:

    • Include effect sizes alongside p-values

    • Report confidence intervals for all key measurements

    • Ensure transparency in data transformation and outlier handling

    • Provide access to raw data and analysis code

When analyzing KPK_5501 data, remember that membrane proteins face unique structural constraints that may introduce additional variability in functional assays, requiring careful statistical control and interpretation.

How can bioinformatics approaches enhance understanding of KPK_5501 function?

Bioinformatics approaches can provide valuable insights into KPK_5501 function through the following methodologies:

  • Sequence-based analysis:

    • Perform multiple sequence alignment of UPF0761 family proteins

    • Identify conserved residues that may indicate functional importance

    • Use the full amino acid sequence to predict transmembrane topology

    • Apply evolutionary coupling analysis to predict residue interactions

  • Structure prediction and analysis:

    • Generate 3D structural models using AlphaFold or RoseTTAFold

    • Validate models through molecular dynamics simulations in membrane environments

    • Identify potential binding pockets and functional sites

    • Compare structural features with characterized membrane proteins

  • Functional prediction pipeline:

Bioinformatic ApproachImplementation MethodExpected Insights
Gene Neighborhood AnalysisExamine genomic context in K. pneumoniaePotential functional associations
Co-expression NetworkAnalyze transcriptomic dataPhysiological context and regulation
Protein-Protein Interaction PredictionMachine learning methodsPotential interaction partners
Comparative GenomicsPresence/absence across bacterial speciesEvolutionary significance and specialization
  • Integration with experimental data:

    • Use bioinformatic predictions to guide mutagenesis experiments

    • Apply machine learning to integrate diverse data types

    • Develop custom algorithms to analyze membrane protein-specific features

    • Consider structural constraints of both function and biosynthesis when interpreting predictions

For KPK_5501 specifically, start with the UniProt ID (B5XZI5) to access comprehensive database information, then expand analysis to related UPF0761 family members to identify functionally important regions.

What are optimal approaches for studying KPK_5501 in native membrane environments?

Studying KPK_5501 in native membrane environments presents unique challenges and opportunities:

  • Native expression systems:

    • Consider K. pneumoniae expression for native lipid environment

    • Develop fluorescent protein fusions for localization studies

    • Implement inducible expression systems to control expression levels

    • Compare with E. coli expression systems commonly used for recombinant production

  • Membrane isolation and analysis techniques:

TechniqueMethodological ApproachKey Controls and Considerations
Membrane FractionationDifferential centrifugation, density gradientsMembrane marker proteins, lipid analysis
In-membrane CrosslinkingPhotoactivatable or chemical crosslinkersCrosslinker specificity, background crosslinking
Native Mass SpectrometrySpecialized detergents, nanodiscs preparationDetergent effects, ionization efficiency
Cryo-Electron TomographyVitrification of native membranesSample thickness, image processing
  • Experimental design considerations:

    • Implement true experimental design with appropriate controls

    • Carefully define and manipulate independent variables

    • Control for extraneous factors that might influence results

    • Consider the balance between structural constraints of function and biosynthesis

  • Functional assessment in native context:

    • Develop assays that can be performed in intact cells or isolated membranes

    • Compare activity in native vs. reconstituted systems

    • Use genetic approaches (knockouts, complementation) to validate function

    • Apply computational modeling to interpret complex native environment data

For KPK_5501 specifically, consider that its high expression level in E. coli suggests it may tolerate heterologous expression well, but native lipid interactions may still be critical for full functional characterization.

What advanced structural biology techniques are most applicable to KPK_5501 characterization?

Advanced structural biology techniques can provide critical insights into KPK_5501 structure and function:

  • Cryo-electron microscopy approaches:

    • Single-particle analysis for purified protein in detergent or nanodiscs

    • Electron tomography for membrane-embedded contexts

    • Microcrystal electron diffraction for small 3D crystals

    • Time-resolved studies for capturing functional states

  • Spectroscopic methods:

TechniqueApplication to KPK_5501Technical Considerations
Solid-state NMRSecondary structure, dynamics in membranesIsotope labeling, reconstitution quality
EPR SpectroscopyDistance measurements, conformational changesSite-directed spin labeling positions
FTIR SpectroscopySecondary structure in native-like environmentsSample preparation, water interference
Hydrogen-Deuterium Exchange MSSolvent accessibility, conformational dynamicsMembrane protein workflow optimization
  • Hybrid approach strategies:

    • Integrate computational models with experimental constraints

    • Combine low and high-resolution techniques

    • Use ensemble methods to capture conformational heterogeneity

    • Apply integrative modeling to synthesize diverse structural data

  • Experimental design considerations:

    • Implement systematic controls for each technique

    • Use factorial designs to test multiple conditions

    • Consider the balance between structural constraints of function and biosynthesis

    • Account for potential effects of the N-terminal His-tag

Given the recombinant expression system established for KPK_5501 , isotope labeling for NMR or HDX-MS studies should be feasible by adapting the existing E. coli expression system to minimal media with labeled nutrients.

How can protein engineering approaches enhance the study of KPK_5501?

Protein engineering provides powerful tools for investigating KPK_5501 structure and function:

  • Site-directed mutagenesis strategies:

    • Alanine scanning of conserved residues

    • Introduction of reporter residues (cysteine, unnatural amino acids)

    • Charge reversal mutations to probe electrostatic interactions

    • Conservative substitutions to test specific chemical properties

  • Fusion protein approaches:

Engineering ApproachMethodological ImplementationResearch Application
Fluorescent Protein FusionsC-terminal or internal fusion constructsLocalization, trafficking studies
Split Protein ComplementationFragment complementation assaysProtein-protein interactions
Thermostability Enhancing MutationsDirected evolution, consensus designImproved expression, structural studies
Solubilization ApproachesTruncation, loop replacementEnhanced solubility, crystallization
  • Advanced engineering considerations:

    • Design constructs with removable tags beyond the His-tag

    • Implement directed evolution to optimize expression and stability

    • Apply computational design to engineer specific functions

    • Consider membrane protein-specific constraints in design strategy

  • Experimental design for engineering studies:

    • Establish clear controls for each engineered variant

    • Implement systematic testing of multiple variants

    • Use factorial design to test combinatorial mutations

    • Apply true experimental design principles with appropriate controls

For KPK_5501 specifically, start with the known sequence to identify conserved residues and predicted functional regions as primary targets for engineering, while maintaining awareness of the delicate balance between structure and function in membrane proteins .

What are the most promising research directions for elucidating KPK_5501 function?

Based on current knowledge and methodological considerations, several research directions show particular promise:

  • Integrated structural-functional studies:

    • Combine structural predictions with targeted functional assays

    • Implement complementary structural approaches (cryo-EM, spectroscopy)

    • Develop activity assays informed by bioinformatic predictions

    • Apply molecular dynamics simulations to explore conformational dynamics

  • Systematic interaction mapping:

    • Screen for protein-protein interactions within bacterial membranes

    • Identify potential small molecule ligands or substrates

    • Characterize lipid interactions and requirements

    • Investigate genomic context and potential operon relationships

  • Physiological role determination:

ApproachMethodological StrategyExpected Insights
Gene Knockout StudiesCRISPR or homologous recombinationPhenotypic consequences, essentiality
Condition-specific ExpressionTranscriptomics under varied conditionsRegulatory patterns, stress responses
Localization StudiesFluorescent tagging, immunolocalizationSubcellular distribution, dynamics
Cross-species ComplementationHeterologous expression in related bacteriaFunctional conservation, specificity
  • Translational applications exploration:

    • Investigate potential roles in antimicrobial resistance

    • Assess as potential therapeutic target

    • Explore biotechnological applications

    • Develop tools based on unique structural properties

These research directions should be pursued with careful experimental design , considering the balance between structural constraints and biosynthesis requirements , and leveraging the established recombinant expression system .

How can contradictory findings about KPK_5501 be reconciled through meta-analysis?

When confronted with contradictory findings about KPK_5501, a systematic meta-analysis approach can help reconcile discrepancies:

  • Structured data compilation:

    • Create comprehensive databases of experimental conditions

    • Standardize outcome measures across studies

    • Code methodological variations systematically

    • Include unpublished negative results when available

  • Meta-analytical framework:

Meta-analysis ComponentImplementation ApproachReconciliation Strategy
Effect Size CalculationConvert diverse outcomes to standardized measuresIdentify consistent effects across methodologies
Heterogeneity AssessmentI² statistic, forest plots, subgroup analysisIdentify sources of systematic variation
Publication Bias AnalysisFunnel plots, trim-and-fill methodsAccount for missing negative findings
Moderator AnalysisMeta-regression on methodological variablesDetermine which factors explain contradictions
  • Advanced reconciliation methods:

    • Apply Bayesian meta-analysis to incorporate prior knowledge

    • Use network meta-analysis for multiple experimental conditions

    • Implement sensitivity analyses to test robustness of findings

    • Develop computational models to explain context-dependent results

  • Experimental design implications:

    • Design validation studies based on meta-analysis findings

    • Implement multi-laboratory replication studies

    • Standardize protocols for key methodologies

    • Consider membrane protein-specific constraints in protocol design

When performing meta-analysis for KPK_5501, particular attention should be paid to expression conditions, purification methods, and functional assay designs, as these are likely sources of variation in results for membrane proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.