Recombinant Klebsiella pneumoniae Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Klebsiella pneumoniae Zinc Transport Protein ZntB (zntB)

Recombinant proteins are produced using recombinant DNA technology, where the gene encoding a specific protein is inserted into a host organism's cells to produce the desired protein . Recombinant Klebsiella pneumoniae Zinc transport protein ZntB (zntB) refers to the protein ZntB, which is involved in zinc transport in Klebsiella pneumoniae, produced via recombinant DNA technology .

Applications of Recombinant Proteins

Recombinant proteins, including ZntB, have diverse applications across various fields .

  • Drug Discovery and Development Recombinant proteins are used to study the structure and function of target proteins involved in diseases, identify potential drug targets, screen potential drug candidates, and evaluate the efficacy and safety of therapeutic agents in preclinical animal models and clinical trials .

  • Diagnostics Recombinant proteins are used as antigens in immunoassays to detect specific antibodies in patient samples for diagnosing infectious diseases, autoimmune disorders, and allergies . They are also used as standards or controls to ensure the accuracy of test results in biochemical analysis techniques and vaccine production .

  • Molecular Biology Research Recombinant proteins facilitate expression studies, protein purification, functional studies, structural biology, drug development, vaccine production, diagnostic tools, and therapeutic proteins development .

  • Cell and Gene Therapy Research and Development Recombinant proteins stimulate cell growth and expansion, induce cell reprogramming, optimize viral vector production, purify therapeutic proteins, characterize cells, modulate the immune response, ensure quality control, facilitate in vivo imaging, and engineer therapeutic proteins with enhanced properties .

Klebsiella pneumoniae and Hypervirulence

Klebsiella pneumoniae is a bacterium known to cause infections, particularly in individuals with weakened immune systems . Recent research has focused on understanding how classical Klebsiella pneumoniae transforms into hypervirulent strains, which can infect healthy individuals . Understanding the genetic elements responsible for hypervirulence is crucial for developing preventive therapies and control strategies .

Recombinant Klebsiella pneumoniae Outer Membrane Proteins (KOMPs) as Vaccine Candidates

Studies have identified several recombinant outer membrane proteins (KOMPs) of Klebsiella pneumoniae as potential vaccine candidates . These KOMPs, such as Kpn_Omp001, Kpn_Omp002, and Kpn_Omp005, have shown promise in inducing protective immune responses against K. pneumoniae infections in murine models . Immunization with these KOMPs resulted in reduced bacterial load in organs, indicating their protective efficacy . The protective effects are associated with KOMP-specific IgG, IgG1, and IgG2a, as well as IFN-γ-, IL4-, and IL17A-mediated immune responses .

Humoral and Cellular Immunity

The study of KOMPs revealed that humoral immunity may contribute to the protective effect of vaccination . Antiserum samples from mice immunized with KOMPs facilitated the killing of K. pneumoniae by HL-60 cells, suggesting the involvement of humoral immunity . Furthermore, these KOMPs elicited a significant increase in IFN-γ-, IL-4-, and IL-17A-secreting splenocytes, indicating that immunization induces strong antigen-specific Th1, Th2, and Th17 responses .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
zntB; KPK_3033; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Klebsiella pneumoniae (strain 342)
Target Names
zntB
Target Protein Sequence
MDAIKGSELQIPDAIFAWVLDGQGGVKPLTDNDIIDKDKPCWLHLNYTHSDSADWLAATP LLPNNVRDALAGESTRPRVTRIGDGALITLRCINGSTDERPDQLVAMRLYMDERLIVSTR QRKVLALDDVLGDLKEGNGPTDGGSWLVEVCDALTDHASEFIEQLHDRIIDLEDDLLDQQ VPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIAERLGRGLDE IDSCIARTAIMSDEIAQIMQESLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGNSWH LGFSLFCLMLVVVIGGVAWWLHRSKWL
Uniprot No.

Target Background

Function

Mediates efflux of zinc ions.

Database Links

KEGG: kpe:KPK_3033

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of ZntB in Klebsiella pneumoniae?

ZntB is a funnel-shaped membrane protein composed of five identical subunits that together form a pore through the bacterial membrane. The full-length structure reveals a pentameric assembly with a total formula weight of approximately 183,260 Da . Each subunit contributes to forming the transport channel, with the intracellular domain creating a wide cytoplasmic funnel that narrows toward the membrane-spanning region. The protein contains distinct domains: a larger cytoplasmic domain and a smaller transmembrane domain that anchors the protein in the cell membrane .

What is the physiological role of ZntB in K. pneumoniae?

ZntB plays a crucial role in zinc homeostasis in K. pneumoniae. While originally thought to function primarily as a zinc exporter similar to other bacterial species, recent research indicates that ZntB actually functions as a zinc importer driven by a proton gradient . This proton-driven zinc transport mechanism is particularly significant for K. pneumoniae pathogenicity, as zinc acquisition is essential during infection when the host environment typically restricts zinc availability through nutritional immunity . Zinc serves as a cofactor for approximately 6% of the bacterial proteome, making its acquisition vital for cellular functions .

How does ZntB differ from other zinc transporters in Klebsiella pneumoniae?

K. pneumoniae employs multiple zinc transport systems, with ZntB functioning distinctly from the ATP-binding cassette (ABC) transporters such as ZnuCBA and ZniCBA . While ZnuCBA and ZniCBA utilize ATP hydrolysis to power zinc uptake, ZntB belongs to the CorA metal ion transporter (MIT) family and uses a proton gradient for energizing transport . Additionally, ZntB forms a homopentameric complex, unlike the heteromeric assembly of ABC transporters. These systems likely function under different physiological conditions, with ZntB possibly serving under specific pH or zinc concentration environments that favor its proton-coupled transport mechanism .

What conformational states have been identified for ZntB and what do they reveal about its transport mechanism?

Two primary conformational states have been identified through structural studies of ZntB: a zinc-free state and a zinc-bound state. The full-length structure of E. coli ZntB (which shares high homology with K. pneumoniae ZntB) reveals the zinc-free state, while the soluble domain structure of Salmonella typhimurium ZntB represents a zinc-bound state . Comparison between these structures reveals dramatic differences in surface electrostatic potentials and internal pore shape . Unlike the related CorA Mg²⁺ channel, ZntB does not collapse into a highly asymmetrical state upon depletion of divalent cations, suggesting a distinct transport mechanism . The conformational transitions likely involve helical rotations, particularly of transmembrane helix TM1, which contains conserved basic and acidic residues that may facilitate the charge inversion observed between conformational states .

What role do electrostatic properties play in ZntB function?

Electrostatic properties are critical for ZntB function. Surface potential calculations reveal significant differences between zinc-free and zinc-bound states . The cytoplasmic domain of full-length zinc-free ZntB exhibits a strong positive electrostatic surface potential, whereas the potential in the zinc-bound state is predominantly negative . This charge inversion between symmetrical states likely facilitates zinc transport through the channel. Additionally, the ZntB structure contains chloride ion binding sites that neutralize positively-charged amino acids, tuning the funnel's properties to favor passage of divalent zinc ions rather than monovalent ions like sodium or potassium . Two rings of acidic amino acids at the base of the funnel may also participate in stripping water molecules from zinc ions before transport .

How does the pentameric assembly of ZntB contribute to its transport function?

The pentameric assembly of ZntB creates a symmetrical pore structure that is essential for its transport function. Each of the five subunits contributes specific residues to form the ion conduction pathway . This pentameric arrangement creates two key functional features: a cytoplasmic funnel that selects for zinc ions through electrostatic interactions, and a narrower transmembrane pore that facilitates controlled ion transport . The symmetrical arrangement allows for coordinated conformational changes during transport cycles, with the five subunits working in concert to regulate zinc passage . This pentameric architecture distinguishes ZntB from many other transport proteins and is shared with other members of the CorA metal ion transporter family, though the transport mechanisms differ considerably .

What are the optimal methods for expressing and purifying recombinant K. pneumoniae ZntB for structural studies?

For structural studies of recombinant K. pneumoniae ZntB, a systematic approach incorporating several key methodologies is recommended. Based on successful protocols used for E. coli ZntB, researchers should:

  • Design expression constructs with a C-terminal purification tag (such as His6 or His8) to minimize interference with the functional N-terminal domain.

  • Express the protein in E. coli BL21(DE3) or similar strains under control of a T7 promoter.

  • Induce expression at lower temperatures (16-18°C) to enhance proper folding of this membrane protein.

  • Extract the protein using mild detergents such as n-dodecyl-β-D-maltopyranoside (DDM) or lauryl maltose neopentyl glycol (LMNG) that maintain the native pentameric structure.

  • Purify using immobilized metal affinity chromatography followed by size exclusion chromatography to isolate the pentameric assembly.

  • Assess protein quality using SDS-PAGE, native PAGE, and thermal stability assays.

For cryo-EM studies specifically, a final concentration of approximately 10 mg/ml is recommended, with application to glow-discharged holey carbon grids .

What techniques are most effective for assessing zinc binding and transport activity of recombinant ZntB?

Several complementary techniques have proven effective for characterizing zinc binding and transport by ZntB:

TechniqueApplicationAdvantagesLimitations
Isothermal Titration Calorimetry (ITC)Direct measurement of binding thermodynamicsProvides binding constants, stoichiometry, and thermodynamic parametersRequires significant amounts of purified protein
Radiolabeled (⁶⁵Zn) uptake assaysDirect measurement of transport in liposomesQuantitatively measures actual zinc transportRequires radioactive materials and specialized facilities
Fluorescent transport assaysIndirect measurement of transport activityNon-radioactive alternative, good for kinetic studiesMay be affected by background fluorescence
Zinc-sensitive fluorescent dyesMonitoring intracellular zinc levelsCan be used in live cell systemsPotential for interference from other metal ions

For the most robust characterization, researchers should employ multiple approaches, particularly combining the direct biophysical measurement of zinc binding (ITC) with functional transport assays using ZntB reconstituted into liposomes .

How can researchers effectively study ZntB conformational changes during the transport cycle?

To effectively study ZntB conformational changes, researchers should employ a multi-technique approach:

  • Cryo-electron microscopy (cryo-EM) has been successfully used to determine the full-length structure of ZntB at 4.2 Å resolution, capturing specific conformational states .

  • Site-directed spin labeling combined with electron paramagnetic resonance (EPR) spectroscopy can monitor distances between specific residues during conformational changes.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify regions of the protein that undergo structural rearrangements upon zinc binding.

  • Single-molecule Förster resonance energy transfer (smFRET) can detect distance changes between labeled domains during the transport cycle.

  • Molecular dynamics simulations based on experimental structures can provide insights into the dynamic processes not captured in static structures.

  • Functional studies with site-directed mutations at key positions can validate the importance of specific residues in the conformational transition.

The comparison between zinc-free and zinc-bound structures has already revealed significant conformational differences and electrostatic surface potential changes that likely represent different stages in the transport cycle .

How does ZntB interact with other zinc homeostasis systems in K. pneumoniae?

K. pneumoniae employs multiple systems for zinc homeostasis, with ZntB functioning alongside the ATP-binding cassette (ABC) transporters ZnuCBA and ZniCBA . These systems likely operate under different conditions or in response to different signals:

  • ZnuCBA and ZniCBA are high-affinity ATP-dependent zinc importers that function redundantly, with either system sufficient for wild-type growth and zinc acquisition under standard laboratory conditions .

  • ZntB provides a proton gradient-driven mechanism for zinc import that may be particularly important under specific environmental conditions, such as acidic microenvironments where the proton gradient is stronger .

  • The expression of these zinc transport systems is likely regulated by zinc-responsive transcription factors, coordinating their activity based on environmental zinc availability.

What is the impact of environmental conditions on ZntB expression and function in K. pneumoniae?

The expression and function of ZntB in K. pneumoniae are likely modulated by several environmental factors, particularly those relevant to infection contexts:

Understanding how these environmental variables affect ZntB expression and function is crucial for comprehending the role of this transporter in K. pneumoniae physiology and pathogenicity under various infection scenarios.

How can researchers design effective inhibitors targeting ZntB for antimicrobial development?

Designing effective inhibitors against K. pneumoniae ZntB requires a structure-guided approach based on the available structural and functional information:

  • Target identification: Several key features of ZntB represent potential targets for inhibition:

    • The zinc binding site

    • The proton coupling mechanism

    • The conformational transition pathway

    • Subunit interfaces in the pentameric assembly

  • Rational design strategies:

    • Structure-based virtual screening using the available ZntB structures to identify compounds that may bind to crucial functional regions

    • Fragment-based drug discovery focusing on the unique features of the zinc transport pathway

    • Design of transition-state analogs that could lock the protein in non-functional conformations

  • Key considerations:

    • Specificity for bacterial ZntB over human zinc transporters to minimize toxicity

    • Penetration of the bacterial outer membrane, particularly challenging in Gram-negative K. pneumoniae

    • Resistance development potential, which may be mitigated by targeting highly conserved and functionally essential regions

  • Validation approaches:

    • In vitro zinc transport assays with purified protein reconstituted in liposomes

    • Bacterial growth assays under zinc-limited conditions

    • Infection models to evaluate efficacy in physiologically relevant contexts

Given that K. pneumoniae is a World Health Organization priority pathogen with increasing antimicrobial resistance , ZntB represents a novel target for therapeutic development that could complement existing treatment strategies.

What are the methodological approaches for studying ZntB in the context of K. pneumoniae biofilms?

Studying ZntB in K. pneumoniae biofilms requires specialized approaches that address the unique properties of the biofilm environment:

These approaches would provide insight into how K. pneumoniae modulates zinc homeostasis in the complex and heterogeneous biofilm environment, which is particularly relevant for chronic infections and antimicrobial resistance.

How can researchers effectively analyze ZntB sequence variations across clinical K. pneumoniae isolates?

To effectively analyze ZntB sequence variations across clinical K. pneumoniae isolates, researchers should employ a comprehensive bioinformatic and functional validation approach:

  • Sequence acquisition and analysis:

    • Whole genome sequencing of diverse clinical isolates

    • PCR amplification and sequencing of the zntB gene from isolates

    • Database mining of existing K. pneumoniae genomes for zntB sequences

  • Bioinformatic analysis pipeline:

    • Multiple sequence alignment to identify conserved and variable regions

    • Phylogenetic analysis to correlate ZntB variants with strain lineages

    • Structural mapping of variations onto the 3D structure of ZntB

    • Prediction of functional impact using computational tools

  • Correlation with clinical data:

    • Association analysis between ZntB variants and infection sites

    • Correlation with antimicrobial resistance profiles

    • Relationship to virulence factor expression and clinical outcomes

  • Functional validation:

    • Heterologous expression of variant ZntB proteins

    • Zinc transport assays to assess functional differences

    • Competition assays between strains with different ZntB variants

    • Site-directed mutagenesis to confirm the importance of specific variations

  • Evolutionary analysis:

    • Assessment of selection pressure on different ZntB domains

    • Identification of recombination events

    • Comparison with ZntB evolution in other bacterial species

This comprehensive approach would provide insights into how ZntB variation might contribute to K. pneumoniae adaptation to different host environments and potentially influence virulence or antimicrobial resistance profiles.

What are the most promising research directions for understanding ZntB regulation in K. pneumoniae?

Several promising research directions could enhance our understanding of ZntB regulation in K. pneumoniae:

  • Transcriptional regulation:

    • Identification of zinc-responsive transcriptional regulators controlling zntB expression

    • Characterization of the zntB promoter and regulatory elements

    • Investigation of cross-talk with other metal-responsive regulatory pathways

  • Post-transcriptional and post-translational regulation:

    • Role of small RNAs in modulating zntB expression

    • Identification of potential protein modifications affecting ZntB activity

    • Protein-protein interactions influencing ZntB localization or function

  • Environmental sensing mechanisms:

    • How zinc levels are sensed and integrated with ZntB expression

    • Role of proton gradient sensing in ZntB regulation

    • Integration with bacterial stress response systems

  • Systems biology approaches:

    • Network analysis of zinc homeostasis in K. pneumoniae

    • Mathematical modeling of zinc transport dynamics

    • Integration of transcriptomic, proteomic, and metabolomic data

  • Infection-relevant regulation:

    • ZntB regulation during different stages of infection

    • Host factors influencing ZntB expression

    • Regulatory changes in antimicrobial resistant isolates

These research directions would provide a comprehensive understanding of how K. pneumoniae regulates ZntB expression and activity to maintain zinc homeostasis under various environmental conditions, potentially revealing new therapeutic targets.

How might advanced structural biology techniques further elucidate the ZntB transport mechanism?

Advanced structural biology techniques could significantly enhance our understanding of the ZntB transport mechanism:

  • Time-resolved cryo-EM:

    • Capturing transient intermediates in the transport cycle

    • Visualization of conformational changes during zinc binding and transport

    • Construction of molecular movies depicting the transport process

  • Single-particle cryo-EM with improved resolution:

    • Higher resolution structures below 3 Å to visualize water molecules and precise ion positions

    • Identification of specific zinc binding sites within the transport pathway

    • Detailed view of the proton coupling mechanism

  • Cryo-electron tomography:

    • Visualization of ZntB in its native membrane environment

    • Understanding of membrane organization and potential clustering

  • Integrative structural biology approaches:

    • Combining cryo-EM with mass spectrometry, spectroscopy, and computational methods

    • Cross-linking mass spectrometry to identify dynamic protein interfaces

    • Molecular dynamics simulations based on high-resolution structures

  • In situ structural studies:

    • Cellular cryo-electron tomography to visualize ZntB in bacterial cells

    • Correlative light and electron microscopy to link structure with function

These advanced approaches would help resolve remaining questions about the precise mechanism of proton-coupled zinc transport, the nature of the conformational changes during the transport cycle, and how the pentameric assembly coordinates these changes for efficient transport.

What experimental approaches could best elucidate the interplay between ZntB and host nutritional immunity during K. pneumoniae infection?

To effectively study the interplay between ZntB and host nutritional immunity during K. pneumoniae infection, researchers should consider these experimental approaches:

  • In vivo infection models:

    • Mouse models of pneumonia, urinary tract infection, or systemic infection

    • Tissue-specific zinc measurements during infection progression

    • Comparison of wild-type and zntB mutant K. pneumoniae virulence

  • Ex vivo analyses:

    • Transcriptional profiling of K. pneumoniae recovered from infection sites

    • Measurement of zntB expression in bacteria isolated from different host tissues

    • Assessment of zinc content in bacteria recovered from host environments

  • Host response studies:

    • Analysis of host zinc transporter expression during infection

    • Characterization of zinc-binding antimicrobial proteins (calprotectin, S100 proteins)

    • Neutrophil extracellular trap (NET) formation and zinc sequestration

  • Advanced imaging techniques:

    • Intravital microscopy with fluorescent zinc probes

    • Immunofluorescence microscopy for co-localization of bacteria with host zinc-binding proteins

    • X-ray fluorescence microscopy for elemental analysis at infection sites

  • Genetic approaches:

    • Construction of K. pneumoniae strains with regulated zntB expression

    • Host models with modified zinc homeostasis (transporter knockouts)

    • Dual RNA-seq to simultaneously profile host and pathogen transcriptional responses

These approaches would provide insights into how K. pneumoniae ZntB functions to overcome host-imposed zinc limitation, potentially revealing new therapeutic strategies targeting this host-pathogen interface.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.