Recombinant Klebsormidium bilatum Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Klebsormidium bilatum Cytochrome b6 (petB) is a full-length, His-tagged protein expressed in heterologous systems such as E. coli or cell-free expression platforms . It corresponds to the petB gene product, a subunit of the cytochrome b6f complex essential for:

  • Photosynthetic electron transport: Facilitates plastoquinol oxidation and plastocyanin reduction, enabling ATP synthesis .

  • State transitions: Modulates light-harvesting complex II (LHCII) phosphorylation and energy distribution between photosystems I and II .

Research Applications

This recombinant protein is utilized in:

  • Structural studies: Investigating the cytochrome b6f complex’s role in electron transport and proton gradient formation .

  • Functional assays: Analyzing petB mutations impacting STT7 kinase activation and LHCII phosphorylation .

  • Comparative biology: Exploring evolutionary differences between cytochrome b6f complexes in algae and higher plants .

Functional Insights from Mutagenesis

Recent studies on homologous systems (e.g., Chlamydomonas reinhardtii) reveal:

  • C-terminal modifications (e.g., truncation at L215b6 or elongation at G216b6) disrupt heme ci binding and complex assembly .

  • Arginine substitution (R207Kb6) slows STT7 phosphorylation kinetics, highlighting redox regulation mechanisms .

Future Research Directions

  • Structural resolution: High-resolution cryo-EM or crystallography to map interaction sites with STT7 kinase .

  • Biotechnological engineering: Optimizing expression yields for industrial-scale production .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Klebsormidium bilatum (Filamentous green alga)
Target Names
petB
Target Protein Sequence
MGKVYDWFEERLEIQAIADDVTSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYLMTDVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVILAVLTVSFGVTGYSLPWDQVGYWAVKIVTGVPEAIPVIGSPLVELLRGSVSVGQSTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 (petB) is a component of the cytochrome b6-f complex. This complex plays a critical role in mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the biological role of Cytochrome b6 in the photosynthetic apparatus of Klebsormidium bilatum?

Cytochrome b6, encoded by the petB gene, serves as a critical component of the multi-subunit cytochrome b6/f complex in the photosynthetic electron transport chain of Klebsormidium bilatum and other green algae. This complex catalyzes the oxidation of quinols and the reduction of plastocyanin, establishing the proton gradient essential for ATP synthesis . In Klebsormidium species, the cytochrome b6 protein contains three heme groups (b-type/c-type cytochrome) that facilitate electron transfer within the complex .

The complete cytochrome b6/f complex consists of four major subunits: the petA gene product (cytochrome f), the petB gene product (cytochrome b6), the petD gene product (subunit IV), and the petC gene product (Rieske/Iron/sulfur protein) . Together, these components form a crucial link between photosystem II and photosystem I in the photosynthetic electron transport chain, making cytochrome b6 essential for photosynthetic efficiency in Klebsormidium bilatum.

How can researchers accurately identify and classify Klebsormidium bilatum for cytochrome b6 studies?

The most reliable method for identifying Klebsormidium bilatum involves combining morphological characterization with molecular phylogenetic analysis. The rbcL gene (encoding the large subunit of ribulose-1,5-bisphosphate carboxylase/oxygenase) serves as the primary molecular marker for Klebsormidium species identification . For accurate classification:

  • Extract DNA following established protocols such as those described by Ryšánek et al. (2015)

  • Amplify the rbcL gene using PCR with appropriate primers such as KF590

  • Sequence the amplified product and perform phylogenetic analysis using methods including:

    • Maximum likelihood (ML)

    • Bayesian inference (BI)

    • Maximum parsimony (MP)

    • Neighbor joining (NJ)

It's important to note that rbcL phylogeny has revealed significantly higher genetic diversity in Klebsormidium than expected from morphological observations alone . Studies have identified multiple distinct clades with high bootstrap support values, indicating that accurate identification requires molecular techniques rather than relying solely on morphological features .

What expression systems and conditions are most effective for producing recombinant Klebsormidium bilatum Cytochrome b6?

While the search results don't directly address expression systems for recombinant K. bilatum cytochrome b6, research with similar photosynthetic proteins suggests the following optimal approach:

Expression ParameterRecommended ConditionRationale
Host systemCyanobacterial or algal expression systemsNative-like membrane environment and cofactor availability
Growth mediumModified Bold's Basal Medium (MBBM) with pH 7.5Optimized for Klebsormidium culture
Temperature cycle20°C (16h) / 15°C (8h)Matches physiological conditions of the source organism
Light conditions50–70 μmol photons m-2 s-1Supports photosynthetic protein expression
Induction methodLight-regulated promotersControls expression timing
Cofactor supplementationHemins or δ-aminolevulinic acidEnsures proper heme incorporation

For successful expression, careful consideration must be given to the incorporation of the three heme groups found in cytochrome b6. Expression in E. coli systems typically requires co-expression of helper proteins for proper heme attachment, while photosynthetic expression hosts may provide a more native environment for correct protein folding and cofactor assembly.

What are the most effective methods for isolating and purifying recombinant Klebsormidium cytochrome b6 while maintaining structural integrity?

Based on established protocols for cytochrome b6f purification from other photosynthetic organisms, a recommended purification workflow would include:

  • Cell disruption: Sonication using parameters optimized for green algae (e.g., 100% power, 30s pulse length, 60s intervals, 8min total)

  • Membrane isolation: Differential centrifugation (148,000g for 16 hours at 4°C)

  • Detergent solubilization: Mild detergents to maintain protein-protein interactions

  • Purification via sucrose density gradient ultracentrifugation

  • Collection of the cytochrome b6f-containing fraction (visible as a brown band)

  • Buffer exchange to remove sucrose and stabilize the purified protein

Quality assessment should include multiple complementary methods:

  • Spectroscopic analysis to confirm proper heme incorporation

  • SDS-PAGE and Western blot analysis using anti-cytochrome b6 antibodies (e.g., against the N-terminal region)

  • Blue native PAGE (BN-PAGE) to assess complex integrity

  • Functional activity assays measuring electron transfer

The expected molecular weight of purified cytochrome b6 is approximately 24 kDa based on homologous proteins .

What high-resolution structural analysis techniques provide the most informative data about Klebsormidium cytochrome b6?

Cryo-electron microscopy (cryo-EM) represents the gold standard for high-resolution structural analysis of cytochrome b6 and the cytochrome b6f complex. This technique has successfully resolved plant cytochrome b6f structures with endogenous plastoquinones and in complex with plastocyanin . For comprehensive structural characterization of Klebsormidium cytochrome b6:

  • Prepare highly purified protein samples as described in the purification protocol

  • Vitrify samples on cryo-EM grids using established techniques

  • Collect high-resolution image data using state-of-the-art electron microscopes

  • Process data using specialized software for single-particle analysis

  • Build and refine atomic models using the electron density maps

Complementary techniques that provide valuable structural information include:

  • X-ray crystallography (if crystals can be obtained)

  • Electron paramagnetic resonance (EPR) spectroscopy for analyzing the electronic structure of the heme groups

  • Hydrogen-deuterium exchange mass spectrometry for probing protein dynamics

The structural data should be analyzed in the context of the four major subunits that comprise the complex and their spatial relationships .

How can researchers accurately measure the electron transport activity of recombinant Klebsormidium cytochrome b6?

For comprehensive functional characterization of recombinant Klebsormidium cytochrome b6, multiple complementary approaches should be employed:

  • Spectrophotometric assays:

    • Monitor the oxidation of reduced plastoquinone analogs

    • Measure the reduction of oxidized plastocyanin

    • Track changes in cytochrome b6 redox state via absorption spectra

  • Reconstitution experiments:

    • Incorporate purified cytochrome b6 into liposomes

    • Measure proton pumping activity across the membrane

    • Assess electron transport rates with artificial electron donors and acceptors

  • Comparative analyses:

    • Benchmark activity against native cytochrome b6f complex

    • Evaluate performance under varying pH, temperature, and ionic conditions

    • Test with electron transport chain components from different species

When designing these assays, researchers should consider the physiological pH range relevant to Klebsormidium. Some strains show adaptation to acidic environments (pH 4.1), which may affect electron transport kinetics compared to standard conditions (pH 7.5) .

How does the molecular structure and function of cytochrome b6 contribute to Klebsormidium's terrestrial adaptation?

Klebsormidium species represent an important evolutionary step in the transition from aquatic to terrestrial environments among green algae. The cytochrome b6 protein likely plays a significant role in this adaptation through several mechanisms:

  • Stress response adaptations:

    • Modified electron transport capabilities under desiccation conditions

    • Adjustment of energy distribution between photosystems during water limitation

    • Protection against excessive reactive oxygen species during environmental stress

  • pH tolerance mechanisms:

    • Some Klebsormidium strains show adaptation to acidic environments (pH 4.1)

    • The cytochrome b6f complex may incorporate structural modifications that maintain function across pH gradients

    • Altered proton pumping efficiency to maintain ATP synthesis under varying pH conditions

  • Research approaches to investigate these adaptations:

    • Compare cytochrome b6 sequences and structures across Klebsormidium strains from different habitats

    • Measure photosynthetic electron transport under controlled dehydration conditions

    • Assess PSII quantum yield (Fv/Fm) during dehydration and rehydration cycles

    • Analyze pH drift and Ci acquisition mechanisms in relation to electron transport function

The high genetic diversity revealed by rbcL phylogeny suggests that cryptic diversity in electron transport components like cytochrome b6 may contribute to the ecological success of Klebsormidium across varied terrestrial niches .

What are common challenges in working with recombinant Klebsormidium cytochrome b6 and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant cytochrome b6 from Klebsormidium. Each issue requires specific troubleshooting approaches:

ChallengePotential CausesResolution Strategies
Poor expression yieldsCodon bias, promoter inefficiency, protein toxicityOptimize codon usage, test multiple promoters, use regulated expression systems
Incomplete heme incorporationInsufficient cofactor availability, improper assemblySupplement growth media with δ-aminolevulinic acid, co-express heme biosynthesis genes
Protein aggregationImproper membrane integration, missing chaperonesLower expression temperature, co-express molecular chaperones, optimize detergent selection
Loss of activity during purificationDetergent effects, cofactor loss, oxidative damageUse milder detergents, add reducing agents, work under anaerobic conditions
Heterogeneous protein populationPost-translational modifications, proteolytic cleavageAdd protease inhibitors, verify protein sequence by mass spectrometry

When working with Klebsormidium-derived proteins, special attention should be paid to temperature and pH conditions, as these organisms demonstrate adaptability to varied environmental conditions that may affect protein stability and function .

How does Klebsormidium bilatum cytochrome b6 compare structurally and functionally to homologs from other photosynthetic organisms?

Cytochrome b6 is highly conserved across photosynthetic organisms, but species-specific variations exist that reflect evolutionary adaptations. For Klebsormidium bilatum:

For accurate species comparison, researchers should use antibodies that recognize conserved epitopes, such as those against the N-terminal region of cytochrome b6 , while being aware of potential cross-reactivity limitations.

What genetic engineering approaches can be used to create modified versions of Klebsormidium cytochrome b6 for functional studies?

Several genetic engineering strategies can be employed to create modified versions of Klebsormidium cytochrome b6 for structure-function studies:

  • Site-directed mutagenesis:

    • Target heme-coordinating residues to alter redox properties

    • Modify amino acids at the interface with other subunits to study protein-protein interactions

    • Introduce mutations corresponding to those found in other species to study evolutionary adaptations

  • Domain swapping:

    • Exchange domains between cytochrome b6 from different species to identify regions responsible for specific properties

    • Create chimeric proteins combining features from multiple organisms

  • Tagging strategies:

    • Introduce fluorescent protein fusions for localization studies

    • Add affinity tags for simplified purification while preserving function

    • Incorporate unnatural amino acids at specific positions for biophysical studies

  • Expression systems:

    • Reconstitution in cyanobacterial or chloroplast systems for in vivo functional assessment

    • Development of Klebsormidium-specific transformation protocols based on methods used for related green algae

When designing these experiments, researchers should use the rbcL phylogeny as a guide for selecting relevant comparator species and strains that represent different evolutionary lineages within Klebsormidium .

What considerations are important when developing antibodies against Klebsormidium cytochrome b6 for research applications?

Development of effective antibodies against Klebsormidium cytochrome b6 requires careful consideration of several factors:

  • Epitope selection:

    • The N-terminal region of cytochrome b6 represents a good target for antibody development

    • KLH-conjugated peptides from conserved regions can generate antibodies with cross-species reactivity

    • Multiple epitopes should be targeted to ensure comprehensive detection

  • Antibody production specifications:

    • Polyclonal antibodies from rabbit hosts show good reactivity across multiple species

    • Expected molecular weight of the target protein is approximately 24 kDa

    • Purified antibody should be validated across a range of applications

  • Recommended applications and conditions:

    • Western blot: 1:1000-1:5000 dilution

    • Blue native PAGE (BN-PAGE) for complex integrity assessment

    • Storage considerations: lyophilized antibody at -20°C (stable for up to 3 years)

    • Reconstitution in 50 μl sterile water with aliquoting to avoid freeze-thaw cycles

  • Cross-reactivity profile:

    • Antibodies designed against conserved regions may cross-react with cytochrome b6 from multiple species including Arabidopsis thaliana, Chlamydomonas reinhardtii, and various other algae and plants

    • This cross-reactivity can be advantageous for comparative studies

What emerging research questions about Klebsormidium cytochrome b6 are most likely to advance our understanding of photosynthetic electron transport?

Several promising research directions could significantly enhance our understanding of Klebsormidium cytochrome b6 and photosynthetic electron transport:

  • Environmental adaptation mechanisms:

    • How does cytochrome b6 structure and function change during desiccation and rehydration cycles?

    • What molecular adaptations enable Klebsormidium to maintain photosynthetic electron transport under variable pH conditions?

    • How does the cytochrome b6f complex contribute to stress resistance in terrestrial environments?

  • Evolutionary perspectives:

    • What can Klebsormidium cytochrome b6 tell us about the evolution of photosynthetic electron transport during the transition to land?

    • How do the four distinct clades identified in Klebsormidium rbcL phylogeny differ in their cytochrome b6 properties?

    • What selection pressures have shaped the evolution of the petB gene in early land plants?

  • Structural biology frontiers:

    • How does the high-resolution structure of Klebsormidium cytochrome b6f compare to that of other organisms?

    • What structural features contribute to the stability of the complex under variable environmental conditions?

    • Can cryo-EM approaches similar to those used for spinach cytochrome b6f reveal unique features of the Klebsormidium complex?

  • Synthetic biology applications:

    • Can engineered variants of Klebsormidium cytochrome b6 enhance photosynthetic efficiency?

    • Is it possible to incorporate stress-tolerance features from Klebsormidium into crop plants?

    • How might hybrid cytochrome b6f complexes combining components from different species perform?

Recent publications, such as Collombat et al. (2025) , continue to advance our understanding of how cytochrome b6 processing affects chloroplast biogenesis and photosynthesis, indicating this remains an active and evolving research area.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.