Recombinant Kluyveromyces delphensis Probable endonuclease LCL3 (LCL3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Kluyveromyces delphensis Probable Endonuclease LCL3 (LCL3)

While the specific compound "Recombinant Kluyveromyces delphensis Probable endonuclease LCL3 (LCL3)" is not widely documented, it can be understood by breaking down its components. The name suggests it is a recombinant protein, an endonuclease, originating from the yeast species Kluyveromyces delphensis. Endonucleases are enzymes that cleave phosphodiester bonds within a nucleic acid strand. Recombinant proteins are produced by introducing the DNA encoding that protein into a host organism, in this case likely K. delphensis, allowing it to express the protein .

Understanding Kluyveromyces delphensis

Kluyveromyces is a genus of yeast known for its diverse metabolic capabilities and industrial applications . Kluyveromyces marxianus, a related species, has notable traits such as thermotolerance (ability to withstand high temperatures), inulinase production, and a rapid growth rate, making it valuable for various biotechnological processes . Genetic studies of K. marxianus have revealed gene resources related to sugar assimilation and species-specific genes, offering insights into its industrial potential .

Endonucleases: Function and Significance

Endonucleases play crucial roles in DNA repair, replication, and recombination . They are essential for maintaining genome stability and integrity. In K. marxianus, genes involved in DNA damage repair pathways, such as homologous recombination and non-homologous end joining, are upregulated under stress conditions, indicating the importance of these enzymes in stress response .

Recombinant Protein Production in Kluyveromyces

Kluyveromyces species are utilized in recombinant protein production . The ability of K. marxianus to produce recombinant proteins is one of its beneficial properties for industrial applications .

Potential Applications of Recombinant LCL3 Endonuclease

Given its nature as a recombinant endonuclease from K. delphensis, LCL3 could have several potential applications:

  • Biotechnology: LCL3 might be used in DNA manipulation, such as in cloning or gene editing techniques.

  • Therapeutic development: Some endonucleases have therapeutic potential, particularly in gene therapy or as antimicrobial agents.

  • Industrial enzyme: LCL3 could be employed in industrial processes requiring specific DNA or RNA cleavage.

Research and Further Study

Further research would be needed to fully elucidate the properties and functions of LCL3. This could include:

  • Cloning and Expression: Cloning the LCL3 gene from K. delphensis and expressing it in a suitable host organism to produce the recombinant protein.

  • Enzyme characterization: Detailed biochemical assays to determine its substrate specificity, optimal reaction conditions, and any cofactors required.

  • Structural studies: Determining the three-dimensional structure of LCL3 to understand its mechanism of action.

  • In vivo studies: Investigating its role within K. delphensis and its impact on cellular processes.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
LCL3; Probable endonuclease LCL3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-258
Protein Length
full length protein
Species
Kluyveromyces delphensis (Yeast)
Target Names
LCL3
Target Protein Sequence
MMSKDKNRTNDVLIEAGLLSLVLTGTTLATYRGYTRYLRQIRNARGIPSKVFRKRWLYGK VTAVGDGDNFHFFHMPGGLFGGWGWLRSTPQLEKIDIVKKSRNSKRLLDFFRSSNKYVDL PVQYKNKRRLPTISVRICGVDAPERSHFGNPAQPYSEEALIWLQHEILGKKLWIKPLNID QYGRCVASIRYWTRFGYKDLSLQMLKEGLALVYEGKSNAEFGGREKIYRRHEFIAKSKRI GMWSQKKLETPGDYKRKL
Uniprot No.

Target Background

Protein Families
LCL3 family
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.

Q&A

What is the function of LCL3 endonuclease in Kluyveromyces delphensis?

LCL3 endonuclease is a site-specific DNA cleaving enzyme that appears to be related to the Ho endonuclease family, which is critical for mating-type switching in yeast species. Based on comparative genomic studies, LCL3 likely functions by recognizing and cleaving specific DNA sequences at the MAT locus in K. delphensis . This activity initiates the genetic recombination process that enables the yeast to switch its mating type.

The specificity of LCL3 is evidenced by its recognition of canonical sequence motifs such as CGCAAC at the Y/Z junction of the MAT locus . This sequence-specific cleavage creates double-strand breaks that trigger the replacement of genetic information at the active MAT locus with information from silent cassettes (HMR/HML), a fundamental mechanism for reproductive versatility in yeast species .

The acquisition of this endonuclease represents a significant evolutionary event, as research suggests that the Ho endonuclease was acquired from a mobile genetic element as part of a two-step evolutionary process that established the mating-type switching system in certain yeast lineages .

What is the evolutionary significance of LCL3 within the Kluyveromyces genus?

The evolutionary history of LCL3 represents a fascinating case study in the acquisition of new genetic capabilities in yeast. Research indicates that Ho-mediated mating-type switching exists only in a specific subset of yeast species, including the Saccharomyces sensu stricto group and close relatives such as Candida glabrata, Kluyveromyces delphensis, and Saccharomyces castellii .

This distribution pattern suggests that the Ho endonuclease (and by extension, LCL3) was acquired relatively recently in evolutionary time. Evidence indicates a two-step evolutionary process: first, the appearance of silent HMR/HML cassettes, followed by the acquisition of the Ho endonuclease from a mobile genetic element . This horizontal gene transfer event fundamentally altered the reproductive strategies available to these yeast species.

The evolutionary relationship between K. delphensis MAT locus and C. glabrata MTL1 locus further demonstrates the conservation of this system in related species, with both containing recognizable Ho endonuclease cleavage sites . These observations provide critical insights into how novel enzymatic activities can be integrated into existing cellular processes through horizontal gene transfer.

How does LCL3 compare to other endonucleases in the Kluyveromyces species?

Comparative analysis reveals significant differences in the organization of mating-type loci and endonuclease function across Kluyveromyces species. While K. delphensis possesses an LCL3/Ho endonuclease system with the cleavage site located within the MATα1 gene, Kluyveromyces lactis shows a different arrangement where MATα1 is located completely within the unique Yα region of MAT .

This structural difference suggests functional divergence in the mating-type switching mechanisms between these related species. The presence of the canonical Ho recognition sequence (CGCAAC) in K. delphensis contrasts with its absence or modification in species lacking Ho-mediated switching .

Research on stress resistance traits in Kluyveromyces species has revealed evidence of adaptive protein variation, particularly in K. marxianus, which demonstrates a history of particularly avid adaptation compared to K. lactis . While this research doesn't directly address LCL3, it provides context for understanding how selective pressures drive protein evolution within this genus.

What are the optimal conditions for recombinant LCL3 expression and purification?

Based on commercial protein specifications, recombinant LCL3 can be successfully expressed in E. coli with an N-terminal His tag, achieving greater than 90% purity as determined by SDS-PAGE . This expression system provides an accessible method for producing research-grade protein.

The recommended purification approach leverages affinity chromatography targeting the His tag, followed by appropriate buffer exchange. The final product is typically provided as a lyophilized powder in a stabilizing buffer (Tris/PBS-based with 6% Trehalose, pH 8.0) .

For optimal stability and activity, researchers should follow these handling guidelines:

ParameterRecommended ConditionNotes
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Centrifuge vial before opening
Storage bufferTris/PBS-based, 6% Trehalose, pH 8.0Consider adding 5-50% glycerol
Long-term storage-20°C/-80°C in aliquotsAvoid repeated freeze-thaw cycles
Working storage4°CStable for up to one week

These conditions help preserve enzymatic activity by preventing protein denaturation and aggregation during storage . The addition of glycerol serves as a cryoprotectant, while aliquoting minimizes the detrimental effects of repeated freezing and thawing.

How can researchers verify the enzymatic activity of purified LCL3?

Verification of LCL3 enzymatic activity requires carefully designed assays that assess its specific DNA cleavage capabilities. Based on its putative function as an Ho-like endonuclease, researchers should consider the following methodological approaches:

First, design synthetic DNA substrates containing the canonical recognition sequence (CGCAAC) identified in K. delphensis MAT locus . Include control substrates with mutated recognition sequences to confirm specificity. Incubate these substrates with purified LCL3 under varying conditions (buffer composition, metal ion cofactors, temperature, and pH).

Analyze cleavage products using high-resolution gel electrophoresis, with particular attention to the generation of specific fragment sizes corresponding to cleavage at the target site. For more precise mapping, sequence the ends of cleaved DNA fragments to determine the exact cleavage position.

Additionally, researchers can develop functional complementation assays, testing whether LCL3 can restore mating-type switching in Ho-deficient yeast strains. This approach provides physiologically relevant evidence of enzymatic function and substrate specificity.

For kinetic characterization, develop real-time assays using fluorescently labeled substrates that exhibit measurable signal changes upon cleavage, enabling determination of important enzymatic parameters (Km, kcat, and catalytic efficiency).

What experimental controls are critical when working with LCL3 in recombinant DNA research?

When conducting experiments with LCL3, especially those involving its potential use in recombinant DNA applications, researchers must implement rigorous controls to ensure data validity and compliance with regulatory guidelines.

The NIH Guidelines for Research Involving Recombinant DNA Molecules classify the deliberate transfer of drug resistance traits to microorganisms as a Major Action requiring special review . While this may not directly apply to LCL3 research, it highlights the importance of appropriate experimental control and regulatory compliance.

Essential experimental controls include:

  • Enzyme activity controls:

    • Positive control: Known active endonuclease with well-characterized activity

    • Negative control: Heat-inactivated LCL3

    • Buffer control: Reaction without enzyme

  • Substrate specificity controls:

    • Recognition site controls: DNA with and without canonical recognition sequence

    • Structural context controls: Recognition sequence in different DNA contexts

  • Technical controls:

    • DNA purity controls: Ensure substrate DNA is free of pre-existing breaks

    • Nuclease contamination controls: Test for non-specific degradation

  • For transformation experiments:

    • Vector-only controls

    • Host strain viability controls

    • Transformation efficiency controls

These controls help distinguish specific enzymatic activity from non-specific effects and ensure experimental reproducibility across different laboratories.

How might LCL3 be utilized in genome editing applications?

While the search results don't explicitly discuss LCL3 in genome editing contexts, its potential applications can be inferred from its enzymatic properties as a site-specific endonuclease. Site-specific DNA cleavage enzymes are foundational tools in genome engineering, creating precisely targeted double-strand breaks that can initiate various DNA repair pathways.

  • Recognition site frequency and distribution in target genomes

  • Cleavage efficiency in different cellular contexts

  • Off-target activity profile

  • Compatibility with existing genome editing frameworks

Potential genome editing strategies might include:

  • Developing LCL3 fusion proteins with programmable DNA-binding domains to expand targeting range

  • Employing LCL3 in conjunction with donor DNA templates to facilitate homology-directed repair

  • Creating catalytically modified versions for applications requiring DNA binding without cleavage

Further research is needed to determine whether LCL3 offers advantages over existing endonucleases for specific genome engineering applications, particularly in industrial yeast strains where species-specific tools may be valuable.

What are common issues encountered when working with recombinant LCL3?

Researchers working with recombinant LCL3 may encounter several technical challenges that could impact experimental outcomes. Understanding these issues and their potential solutions is essential for successful implementation in research protocols.

One common challenge is protein stability during storage and handling. The recombinant protein is provided as a lyophilized powder that requires proper reconstitution and storage to maintain activity . Inappropriate handling can lead to protein denaturation, aggregation, or loss of catalytic function. Researchers should strictly follow the recommended storage conditions: storing at -20°C/-80°C upon receipt, reconstituting in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and adding 5-50% glycerol for long-term storage .

Another frequent issue is suboptimal reaction conditions for enzymatic activity. As a yeast-derived endonuclease, LCL3 may have specific requirements for buffer composition, pH, salt concentration, and metal ion cofactors that differ from those of commonly used restriction enzymes. Systematic optimization of these parameters is often necessary to achieve maximal activity.

Additionally, researchers may encounter challenges related to substrate specificity and recognition. The precise recognition sequence and structural context requirements for efficient cleavage need to be carefully considered when designing substrates for activity assays or target sequences for genome engineering applications.

How can researchers optimize buffer conditions for LCL3 enzymatic assays?

Optimizing buffer conditions is crucial for maximizing LCL3 enzymatic activity and ensuring reproducible experimental results. While specific optimal conditions are not detailed in the search results, a systematic approach to buffer optimization can be recommended based on general principles of endonuclease biochemistry.

Start with the storage buffer composition (Tris/PBS-based buffer, pH 8.0 with 6% Trehalose) as a baseline, then systematically vary key parameters:

ParameterRange to TestConsiderations
pH6.5 - 9.0Test in 0.5 pH unit increments
Buffer typeTris, HEPES, PhosphateMay affect metal ion availability
Salt (NaCl/KCl)0 - 200 mMIonic strength affects DNA binding
Divalent cationsMg²⁺, Mn²⁺, Ca²⁺, Zn²⁺Essential for catalysis in most endonucleases
Reducing agentsDTT, β-mercaptoethanol (0-5 mM)May protect catalytic cysteine residues
StabilizersBSA, glycerol (0-10%)Prevent surface adsorption and denaturation
Temperature25°C - 37°CBalance activity with stability

For each condition, measure relative enzymatic activity using a standardized assay. Once individual parameters are optimized, perform factorial experiments to identify potential interaction effects between variables. This systematic approach will yield a robust reaction buffer that maximizes LCL3 activity while maintaining stability.

Remember that optimal conditions may vary depending on the specific application, substrate composition, and reaction time. Additional fine-tuning may be necessary when adapting protocols for new experimental contexts.

What strategies can resolve protein aggregation issues with recombinant LCL3?

Protein aggregation is a common challenge when working with recombinantly expressed enzymes like LCL3. Aggregation can significantly reduce enzymatic activity and complicate experimental procedures. Several strategies can help prevent or resolve aggregation issues:

First, optimize the reconstitution process by ensuring gradual addition of buffer to the lyophilized powder with gentle mixing rather than vigorous vortexing . Initial reconstitution at lower protein concentrations (0.1-0.5 mg/mL) may reduce aggregation propensity compared to higher concentrations.

Buffer additives can significantly improve solubility. The storage buffer already contains 6% trehalose as a stabilizer , but additional components may be beneficial:

  • Mild non-ionic detergents (0.01-0.1% Triton X-100 or NP-40)

  • Amino acid additives (50-500 mM arginine or proline)

  • Osmolytes (glycerol, sucrose, or mannitol)

  • Carrier proteins (0.1-1.0 mg/mL BSA)

Physical methods to address existing aggregation include centrifugation to remove large aggregates, filtration through appropriate molecular weight cutoff membranes, or size exclusion chromatography to isolate properly folded monomeric protein.

If aggregation occurs during long-term storage, aliquoting into smaller volumes and storing at -80°C with added cryoprotectants like glycerol (5-50%) can minimize freeze-thaw induced aggregation. For working stocks, storage at 4°C for up to one week is recommended to avoid repeated freeze-thaw cycles .

How can researchers validate the specificity of LCL3 in DNA cleavage assays?

Validating the sequence specificity of LCL3 is essential for both fundamental research and potential applications in genome engineering. A comprehensive validation strategy should incorporate multiple complementary approaches to confirm the enzyme's recognition preferences and cleavage patterns.

Begin with in vitro cleavage assays using synthetic DNA substrates containing the putative recognition sequence (CGCAAC) identified in the K. delphensis MAT locus . Create a panel of variant substrates with systematic mutations in and around this sequence to define the recognition motif precisely. Analyze cleavage products using high-resolution gel electrophoresis and sequencing to map exact cleavage positions.

A more comprehensive approach involves genome-wide methodologies:

  • In vitro genomic DNA digestion followed by next-generation sequencing of cleavage sites

  • Chromatin immunoprecipitation using catalytically inactive LCL3 to identify binding sites in vivo

  • SELEX (Systematic Evolution of Ligands by Exponential Enrichment) to define sequence preferences from random DNA libraries

Comparative analysis with related endonucleases can provide valuable context. For example, comparing LCL3 specificity with the Ho endonuclease from S. cerevisiae, which recognizes similar sequences , may reveal subtle differences in sequence recognition that could be exploited for specific applications.

Finally, functional validation through complementation assays in appropriate yeast systems can confirm physiological relevance of the identified specificity patterns.

How can LCL3 contribute to studying evolutionary mechanisms in yeast species?

LCL3 represents a valuable tool for investigating evolutionary mechanisms in yeast, particularly those related to reproductive strategies and horizontal gene transfer. Research indicates that the mating-type switching system in yeasts evolved through a two-step process: first, the appearance of silent HMR/HML cassettes, followed by acquisition of the Ho endonuclease from a mobile genetic element .

This evolutionary history makes LCL3 an excellent model for studying how horizontally acquired genes integrate into existing cellular pathways and drive the evolution of new traits. Researchers can use comparative analyses of LCL3 and related proteins across yeast species to reconstruct the evolutionary trajectory of mating-type switching mechanisms.

The distribution of Ho-mediated switching among yeast species (present in Saccharomyces sensu stricto, C. glabrata, K. delphensis, and S. castellii, but absent in other yeasts) provides a natural experiment for investigating the genetic and ecological factors that influence the acquisition and retention of novel enzymatic functions.

Additionally, research on K. marxianus has demonstrated evidence for adaptive protein variation involving hundreds of housekeeping genes with signatures of positive selection . While this finding doesn't directly address LCL3, it establishes the Kluyveromyces genus as a powerful model for studying the molecular mechanisms of adaptation and species divergence.

What potential applications exist for LCL3 in biotechnology and genetic engineering?

The site-specific DNA cleavage activity of LCL3 suggests several potential applications in biotechnology and genetic engineering, particularly for systems involving yeast manipulation. Although the search results don't explicitly discuss these applications, we can infer possibilities based on the enzyme's properties.

In yeast genetic engineering, LCL3 could potentially be developed as a species-specific genome editing tool, particularly for Kluyveromyces strains used in industrial biotechnology. The specificity for sequences like CGCAAC could be exploited to target particular genomic regions for modification. This specificity might offer advantages over more general nucleases in certain applications.

For strain development in industrial biotechnology, LCL3-based genetic switches could potentially be engineered to control gene expression or facilitate directed evolution strategies. The natural role of LCL3/Ho in mating-type switching suggests potential applications in controlling yeast sexual cycles for strain improvement programs.

More broadly, understanding the specificity determinants of LCL3 could contribute to the development of engineered endonucleases with novel specificities for targeted genome editing applications. This would expand the available toolkit for precise genetic manipulation in both research and applied settings.

It's worth noting that any application involving recombinant DNA technology would need to comply with appropriate regulatory frameworks, such as the NIH Guidelines that classify certain types of recombinant DNA experiments as Major Actions requiring special review .

How might comparative studies between LCL3 and related endonucleases advance our understanding of protein structure-function relationships?

Comparative studies between LCL3 and related endonucleases offer valuable opportunities to uncover fundamental principles governing protein structure-function relationships, particularly in site-specific DNA recognition and cleavage mechanisms.

The evolutionary relationship between LCL3 and the Ho endonuclease family provides a natural experiment in protein evolution. By comparing LCL3 with Ho endonucleases from other species like S. cerevisiae, researchers can identify conserved residues essential for core catalytic functions versus variable regions that determine species-specific recognition patterns.

Such comparative analyses could reveal principles that extend beyond these specific enzymes to inform our broader understanding of protein-DNA interactions and the evolution of sequence specificity. These insights could ultimately contribute to the rational design of engineered endonucleases with novel specificities for biotechnology applications.

Structural biology approaches comparing LCL3 with related endonucleases would be particularly valuable, as they could reveal how subtle differences in protein architecture translate into functional differences in substrate recognition and catalytic activity.

What are the most promising research directions for further characterization of LCL3?

Several high-priority research directions would significantly advance our understanding of LCL3 structure, function, and potential applications. These directions represent logical next steps based on the current state of knowledge reflected in the search results.

First, comprehensive biochemical characterization of LCL3 enzymatic properties would establish fundamental parameters such as sequence specificity, cleavage mechanism, cofactor requirements, and kinetic parameters. This characterization would provide the foundation for all subsequent applied research.

Structural biology approaches, including X-ray crystallography or cryo-electron microscopy of LCL3 alone and in complex with DNA substrates, would reveal the molecular basis of its sequence recognition and catalytic mechanism. These structural insights would be particularly valuable when compared with other Ho-family endonucleases to identify conserved and divergent features.

Genetic studies exploring the physiological role of LCL3 in K. delphensis would provide context for its biochemical activities. While its involvement in mating-type switching can be inferred from comparative genomics , direct experimental confirmation would strengthen this connection.

Finally, protein engineering approaches could explore the potential to modify LCL3 specificity or activity for biotechnological applications. This might include creating fusion proteins with programmable DNA-binding domains or evolving variants with novel recognition properties.

Together, these research directions would develop LCL3 from a biochemically interesting protein into a well-characterized molecular tool with potential applications in both fundamental research and biotechnology.

Recommendations for researchers working with LCL3 in academic settings

For researchers planning to work with LCL3 in academic settings, several practical recommendations emerge from the available literature:

  • Start with optimized handling protocols for the recombinant protein: reconstitute lyophilized protein in deionized sterile water (0.1-1.0 mg/mL), add glycerol to 5-50% final concentration, aliquot to avoid repeated freeze-thaw cycles, and store at -20°C/-80°C for long-term storage or at 4°C for up to one week for working stocks .

  • Develop robust activity assays using DNA substrates containing the putative recognition sequence (CGCAAC) , with appropriate controls to distinguish specific from non-specific activity.

  • Consider comparative approaches that leverage knowledge about related Ho endonucleases from other yeast species, particularly when designing experiments to characterize sequence specificity.

  • For projects involving genetic manipulation, be aware of regulatory considerations under guidelines such as the NIH Guidelines for Research Involving Recombinant DNA Molecules .

  • Explore collaborations across disciplines (biochemistry, structural biology, yeast genetics, protein engineering) to develop a comprehensive understanding of LCL3 structure and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.